KEGG   Ferroglobus placidus: Ferp_0838Help
Entry
Ferp_0838         CDS       T01172                                 

Definition
CoB--CoM heterodisulfide reductase (EC:1.8.98.1)
Orthology
K03389  
heterodisulfide reductase subunit B [EC:1.8.98.1]
Organism
fpl  Ferroglobus placidus
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ferp_0838
  Energy metabolism
   00680 Methane metabolism
    Ferp_0838
Enzymes [BR:fpl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.98  With other, known, acceptors
    1.8.98.1  CoB---CoM heterodisulfide reductase
     Ferp_0838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
736136..737014
Genome map
AA seq 292 aa AA seqDB search
MKFGFFLGCQIPFLKPEVEASIRKVMSALGVELIDLEGYSCCPTWMSVPSLDLNAWLSIS
ARNLAIAENLGVDVVTGCNNCFSVLNHARYLLKDEKRKFEVNRILSKFGKFYRGTSKVYH
VIHVLSDFVDKKELKKKVVHPLKDLTVAIHPGCQLLWPTRIMDVKEENPFYPEKLKNLVE
MLGAKAPYYSRLDYCCGAGTSVAYIDYEKSSYFVLTKLESMKEEIEPDLIVTPCSTCLIQ
IEEMQKKLKKDGKINFEIPVVYYTQLLAICMGIPANEVFREESAKIILEVIR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcggcttctttctcgggtgtcaaattcccttcctaaaacccgaggtcgaagct
tcgataaggaaagtcatgagcgctcttggagtagaactcatcgatctcgaaggatactcc
tgctgtcccacgtggatgtctgttccaagtctcgatttaaacgcttggctgtccatttcc
gcgagaaatctggctatagctgaaaatctcggagtggacgttgtgaccggatgcaacaac
tgcttcagcgttttaaatcacgcgagataccttctgaaagatgaaaaaaggaagttcgaa
gtaaacagaattctctcaaaattcggcaaattttacagaggaacttctaaggtgtaccac
gtaattcacgttctatccgactttgttgacaaaaaggagttaaagaagaaagtcgtgcat
cccctaaaagatttgaccgtcgcgattcatccgggttgtcagctcctgtggcctacgaga
ataatggacgtaaaagaggagaatccgttttatcctgaaaaactaaagaatcttgtagag
atgctcggagcaaaagcaccctactacagcagactcgactactgctgcggagctgggact
tccgttgcatacatagactacgagaaatcatcatacttcgttctgacgaaactcgaatcg
atgaaagaagagatagagccggatctcatcgttactccgtgctcaacgtgcctcatacaa
attgaagaaatgcagaagaaacttaaaaaagatggtaaaataaacttcgagattccggtc
gtttactacacccagcttttggcaatttgcatgggaattccagctaacgaagttttcaga
gaagagagcgcaaagataattcttgaggtgattagatga

DBGET integrated database retrieval system