KEGG   Ferroglobus placidus: Ferp_0838Help
Entry
Ferp_0838         CDS       T01172                                 

Definition
(GenBank) CoB--CoM heterodisulfide reductase
  KO
K03389  heterodisulfide reductase subunit B2 [EC:1.8.7.3 1.8.98.4 1.8.98.5 1.8.98.6]
Organism
fpl  Ferroglobus placidus
Pathway
fpl00680  Methane metabolism
fpl01100  Metabolic pathways
fpl01120  Microbial metabolism in diverse environments
fpl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Ferp_0838
Enzymes [BR:fpl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.7  With an iron-sulfur protein as acceptor
    1.8.7.3  ferredoxin:CoB-CoM heterodisulfide reductase
     Ferp_0838
   1.8.98  With other, known, physiological acceptors
    1.8.98.4  coenzyme F420:CoB-CoM heterodisulfide,ferredoxin reductase
     Ferp_0838
    1.8.98.5  H2:CoB-CoM heterodisulfide,ferredoxin reductase
     Ferp_0838
    1.8.98.6  formate:CoB-CoM heterodisulfide,ferredoxin reductase
     Ferp_0838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCG
Motif
Other DBs
NCBI-ProteinID: ADC65006
UniProt: D3RWZ3
Position
736136..737014
Genome map
AA seq 292 aa AA seqDB search
MKFGFFLGCQIPFLKPEVEASIRKVMSALGVELIDLEGYSCCPTWMSVPSLDLNAWLSIS
ARNLAIAENLGVDVVTGCNNCFSVLNHARYLLKDEKRKFEVNRILSKFGKFYRGTSKVYH
VIHVLSDFVDKKELKKKVVHPLKDLTVAIHPGCQLLWPTRIMDVKEENPFYPEKLKNLVE
MLGAKAPYYSRLDYCCGAGTSVAYIDYEKSSYFVLTKLESMKEEIEPDLIVTPCSTCLIQ
IEEMQKKLKKDGKINFEIPVVYYTQLLAICMGIPANEVFREESAKIILEVIR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcggcttctttctcgggtgtcaaattcccttcctaaaacccgaggtcgaagct
tcgataaggaaagtcatgagcgctcttggagtagaactcatcgatctcgaaggatactcc
tgctgtcccacgtggatgtctgttccaagtctcgatttaaacgcttggctgtccatttcc
gcgagaaatctggctatagctgaaaatctcggagtggacgttgtgaccggatgcaacaac
tgcttcagcgttttaaatcacgcgagataccttctgaaagatgaaaaaaggaagttcgaa
gtaaacagaattctctcaaaattcggcaaattttacagaggaacttctaaggtgtaccac
gtaattcacgttctatccgactttgttgacaaaaaggagttaaagaagaaagtcgtgcat
cccctaaaagatttgaccgtcgcgattcatccgggttgtcagctcctgtggcctacgaga
ataatggacgtaaaagaggagaatccgttttatcctgaaaaactaaagaatcttgtagag
atgctcggagcaaaagcaccctactacagcagactcgactactgctgcggagctgggact
tccgttgcatacatagactacgagaaatcatcatacttcgttctgacgaaactcgaatcg
atgaaagaagagatagagccggatctcatcgttactccgtgctcaacgtgcctcatacaa
attgaagaaatgcagaagaaacttaaaaaagatggtaaaataaacttcgagattccggtc
gtttactacacccagcttttggcaatttgcatgggaattccagctaacgaagttttcaga
gaagagagcgcaaagataattcttgaggtgattagatga

DBGET integrated database retrieval system