KEGG   Ferroglobus placidus: Ferp_0838Help
Entry
Ferp_0838         CDS       T01172                                 

Definition
CoB--CoM heterodisulfide reductase (EC:1.8.98.1)
Orthology
K03389  
heterodisulfide reductase subunit B [EC:1.8.98.1]
Organism
fpl  Ferroglobus placidus
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:fpl01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:fpl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
736136..737014
Genome map
AA seq 292 aa AA seqDB search
MKFGFFLGCQIPFLKPEVEASIRKVMSALGVELIDLEGYSCCPTWMSVPSLDLNAWLSIS
ARNLAIAENLGVDVVTGCNNCFSVLNHARYLLKDEKRKFEVNRILSKFGKFYRGTSKVYH
VIHVLSDFVDKKELKKKVVHPLKDLTVAIHPGCQLLWPTRIMDVKEENPFYPEKLKNLVE
MLGAKAPYYSRLDYCCGAGTSVAYIDYEKSSYFVLTKLESMKEEIEPDLIVTPCSTCLIQ
IEEMQKKLKKDGKINFEIPVVYYTQLLAICMGIPANEVFREESAKIILEVIR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcggcttctttctcgggtgtcaaattcccttcctaaaacccgaggtcgaagct
tcgataaggaaagtcatgagcgctcttggagtagaactcatcgatctcgaaggatactcc
tgctgtcccacgtggatgtctgttccaagtctcgatttaaacgcttggctgtccatttcc
gcgagaaatctggctatagctgaaaatctcggagtggacgttgtgaccggatgcaacaac
tgcttcagcgttttaaatcacgcgagataccttctgaaagatgaaaaaaggaagttcgaa
gtaaacagaattctctcaaaattcggcaaattttacagaggaacttctaaggtgtaccac
gtaattcacgttctatccgactttgttgacaaaaaggagttaaagaagaaagtcgtgcat
cccctaaaagatttgaccgtcgcgattcatccgggttgtcagctcctgtggcctacgaga
ataatggacgtaaaagaggagaatccgttttatcctgaaaaactaaagaatcttgtagag
atgctcggagcaaaagcaccctactacagcagactcgactactgctgcggagctgggact
tccgttgcatacatagactacgagaaatcatcatacttcgttctgacgaaactcgaatcg
atgaaagaagagatagagccggatctcatcgttactccgtgctcaacgtgcctcatacaa
attgaagaaatgcagaagaaacttaaaaaagatggtaaaataaacttcgagattccggtc
gtttactacacccagcttttggcaatttgcatgggaattccagctaacgaagttttcaga
gaagagagcgcaaagataattcttgaggtgattagatga

DBGET integrated database retrieval system