KEGG   Ferroglobus placidus: Ferp_0858Help
Entry
Ferp_0858         CDS       T01172                                 

Definition
histone acetyltransferase, ELP3 family (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
fpl  Ferroglobus placidus
Brite
Enzymes [BR:fpl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Ferp_0858
Transfer RNA biogenesis [BR:fpl03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Ferp_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(751250..752824)
Genome map
AA seq 524 aa AA seqDB search
MDYRTACVEIAKEILRRGVEDKRVVGRIKREFAKKFKLDRFPSDADILKFSENLEGYEKL
RRILKVKPVRTLSGVAVVSVMSSPAICPHGKCVPCPGGVEFNTPQSYIGLEPAAQRGKQF
NYDPFKQVSARLKELKAIGHAVDKVEVIVMGGTFIAREKEYRDSFILGIYRALNSFEDEL
DLSKTVEEAKLKNEKAKARCVGMTFETRPDYSKEEHIIEMLRYGGTKVELGVQSVYDDVL
EKINRGHGVREVVEATKLLRDSAFKVGYHVMPGLPGSSFERDLKMFKILFQDEKFKPDYL
KIYPTIVVRGTKLYEMYERGEYEPYTTEEVVELIAKAKKYIPEYVRIQRIQRDIPVNASI
GIDKGNIRQLVHERLKELGYSCRCIRCREAGLKLKKFEEKDFELVVREYKASDGKEFFIS
YEIPSEDVLIGFIRLRFPDEPFIDVLRDCALIRELHVYGEAVPISKEENEAFQHRGFGEK
LLKQAEEIAKEKYDRIAVISGVGVREYYRRRGYKKEFEYMVKKL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggactacagaacggcgtgcgtagaaatagccaaggaaattctgaggaggggagttgaa
gataaaagggtagtcggcagaataaagagggagtttgcgaagaagtttaagctcgatagg
tttccgagcgatgcggacatcttaaagttctccgaaaatttggagggttacgaaaagctg
agaagaattctgaaagttaagcccgtaagaactctgagcggagtagctgtggttagcgtt
atgagttccccagctatatgcccccacggcaaatgcgtcccttgcccggggggagttgag
ttcaacacacctcagagctacatcggcttagagccagcagctcagagaggaaagcaattc
aactacgaccctttcaagcaagtttctgcgaggctcaaagaattgaaagctatcggacac
gctgtagacaaggttgaggtaatagtcatgggaggaacttttatagcgagagagaaagag
tacagagacagctttatcctcggaatatacagagctttgaacagctttgaggatgaactc
gatctttctaagactgttgaagaagcgaagctgaaaaacgaaaaagctaaggcgagatgc
gtcggaatgacctttgaaactcgtccggattattctaaggaggagcatataatcgagatg
cttagatacggagggacgaaggttgaactcggagttcaaagcgtttacgacgacgttctt
gaaaaaataaacagaggacacggagtgagggaggttgtggaagcgacgaagcttttgagg
gattcagctttcaaagttggctaccacgtaatgccggggttgccgggaagcagtttcgag
agggatttgaagatgttcaagattctcttccaagacgaaaaattcaagccggattacctg
aaaatttatccgaccatagtcgttagggggactaagctctacgaaatgtacgagagagga
gaatacgagccttacaccactgaagaggtcgttgagttaattgcgaaagctaaaaagtac
attcccgaatacgtaagaattcagagaattcagcgcgacattcccgtcaatgcttctata
gggatagacaaggggaacataaggcagctcgtccacgagaggctgaaagagcttggatat
tcttgcagatgcatcaggtgtagagaagctggattgaagcttaagaagtttgaagaaaag
gatttcgaacttgtggtgagagagtataaggcttctgatggaaaggagttctttatttca
tacgaaattccgagcgaggacgtcttaataggttttataaggctgagatttccagacgaa
ccgtttatagatgttttgagagactgtgctttaataagggagctgcacgtttacggagag
gctgttccgataagtaaagaagaaaatgaagcttttcagcacaggggttttggcgagaag
cttttaaagcaagctgaggagatagcgaaggagaagtacgacagaatagctgttataagc
ggggtcggtgtgagggagtattacaggagaaggggatataaaaaggagttcgaatacatg
gtgaaaaagctatga

DBGET integrated database retrieval system