KEGG   Ferroglobus placidus: Ferp_0893Help
Entry
Ferp_0893         CDS       T01172                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
fpl  Ferroglobus placidus
Pathway
fpl00010  Glycolysis / Gluconeogenesis
fpl00020  Citrate cycle (TCA cycle)
fpl00620  Pyruvate metabolism
fpl00633  Nitrotoluene degradation
fpl00640  Propanoate metabolism
fpl00650  Butanoate metabolism
fpl00680  Methane metabolism
fpl00720  Carbon fixation pathways in prokaryotes
fpl01100  Metabolic pathways
fpl01120  Microbial metabolism in diverse environments
fpl01130  Biosynthesis of antibiotics
fpl01200  Carbon metabolism
Module
fpl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferp_0893
   00020 Citrate cycle (TCA cycle)
    Ferp_0893
   00620 Pyruvate metabolism
    Ferp_0893
   00640 Propanoate metabolism
    Ferp_0893
   00650 Butanoate metabolism
    Ferp_0893
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ferp_0893
   00680 Methane metabolism
    Ferp_0893
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ferp_0893
Enzymes [BR:fpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ferp_0893
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 Fer4_6 Fer4_2 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_22 Fer4_4 Fer4_13 Fer4_15 Fer4_17 Fer4_8 Fer4_3 Fer4_18
Motif
Other DBs
NCBI-ProteinID: ADC65061
UniProt: D3RX48
Position
784020..784313
Genome map
AA seq 97 aa AA seqDB search
MERMKLYIGASNPPKTTQMKTGDWGTEWAFVDEEKCIGCGRCVKFCPEPCIELVEKDGNK
VAKVDHDYCKGCGICASVCPVNAIRMETKEIYKVEVC
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaatgaagctttatataggagcgagcaacccgccgaaaaccactcagatgaaa
accggagattgggggaccgagtgggcttttgtggacgaagagaagtgtattggctgcgga
agatgcgttaaattctgccccgagccgtgtatcgagctcgtggagaaagacggaaacaag
gtagcgaaagtcgatcacgactactgcaagggttgcggaatttgcgcaagcgtttgcccg
gttaacgctattaggatggagactaaagaaatttacaaggtcgaggtgtgttaa

DBGET integrated database retrieval system