KEGG   Ferroglobus placidus: Ferp_0895Help
Entry
Ferp_0895         CDS       T01172                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
fpl  Ferroglobus placidus
Pathway
fpl00010  Glycolysis / Gluconeogenesis
fpl00020  Citrate cycle (TCA cycle)
fpl00620  Pyruvate metabolism
fpl00633  Nitrotoluene degradation
fpl00640  Propanoate metabolism
fpl00650  Butanoate metabolism
fpl00680  Methane metabolism
fpl00720  Carbon fixation pathways in prokaryotes
fpl01100  Metabolic pathways
fpl01120  Microbial metabolism in diverse environments
fpl01130  Biosynthesis of antibiotics
fpl01200  Carbon metabolism
Module
fpl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferp_0895
   00020 Citrate cycle (TCA cycle)
    Ferp_0895
   00620 Pyruvate metabolism
    Ferp_0895
   00640 Propanoate metabolism
    Ferp_0895
   00650 Butanoate metabolism
    Ferp_0895
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ferp_0895
   00680 Methane metabolism
    Ferp_0895
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ferp_0895
Enzymes [BR:fpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ferp_0895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C Gly_kinase CoA_trans
Motif
Other DBs
NCBI-ProteinID: ADC65063
UniProt: D3RX50
Position
785486..786364
Genome map
AA seq 292 aa AA seqDB search
MSYFGPGHGACPGCGFPIAVKAVLEALEGKAFVVNPTGCLEIVSSMYNRNVWGVPYIHSL
FENAAAVAAGIEAALRALNRKHEGHVVVFAGDGATADIGFGMVSGAFDRNHDILYICYDN
EAYQNTGNQQSALTPPGARTTTTPVGKRQPGKIGKKKDMVSIAVAHGIPYVASASVGYPN
DLKRKVKRAVEFEGAKYIHVHAPCVTGWGIDGKQTVEVARLAVETGLYPLVEFEHGKLVR
VMKIKEKKPVEEYLKAQRRFRHLFKHPEGRKIIEELQRIADENIKRYNLLQQ
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagttatttcggacccgggcacggagcctgtcccggttgcggatttcccatcgctgta
aaagccgtgctcgaagctttggaagggaaggctttcgtcgtaaatccaaccggatgctta
gagatagttagctcgatgtacaacagaaacgtctggggagttccctacattcactccctt
ttcgagaacgctgcagccgttgctgcgggaattgaggcagctctcagagctttgaataga
aagcacgaaggacacgttgtcgttttcgccggagacggtgctactgctgacataggtttc
ggtatggtttccggagcattcgacagaaatcacgacattctctacatctgctacgacaac
gaagcgtatcagaacaccggaaatcagcaaagcgcgttaactcctccgggagcgaggacc
actacaacgccagtcggaaaaagacagccgggaaagatcgggaagaaaaaggacatggtt
agcatagcagtcgcccacggaattccctacgttgcttcagcttcggtaggctatccaaac
gacttaaagaggaaagtgaagagggctgttgaattcgaaggagcgaagtacatccacgtt
cacgcaccgtgcgttactggctggggaatcgacggtaaacagactgttgaagtggcgagg
ctggctgtcgaaaccggactgtatcctctcgtggaattcgaacacggaaagctcgtgagg
gttatgaaaatcaaggagaagaagcccgtggaagagtacctcaaagctcaaaggaggttc
aggcacctgttcaaacatccggaaggtaggaagattatagaagagcttcagagaatagcg
gacgagaacataaagaggtacaacctcctgcagcaatga

DBGET integrated database retrieval system