KEGG   Ferroglobus placidus: Ferp_1052Help
Entry
Ferp_1052         CDS       T01172                                 

Definition
PfkB domain protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
fpl  Ferroglobus placidus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ferp_1052
Enzymes [BR:fpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Ferp_1052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
920996..921886
Genome map
AA seq 296 aa AA seqDB search
MIVGFGALNLDKIYLVDKIPREDEEGYVIDVELHPGGSAANTIAGLASFGVKTGYVGKVG
SDAEGEMLVEDFRKRGVDLSGIVKSEGRSGQALIFVDRNGNRAILVDPGVNDTIKFEEVN
KELIEKAEIVHMTSFICKNGTDSLESQKKVAKVAKAVSFDPGLPYVERGLEEIREIVERT
TILLPNKTEIEKLVGKDFREAAKEMIEEGVKVVAVKLGEKGCYVTDGKEEHFIEAFKANV
VDTTGAGDAFNAGFLYGWMKGKSLEACGKLGNYVASKIVERVGARNYEGIDPEKFV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgatagttggattcggagctttgaacctcgataagatctatctcgtcgacaaaattccg
agagaggacgaggaagggtatgtgatagacgtggagcttcacccgggagggagtgcggca
aacactatagccggactggcgagctttggcgtaaaaaccggatacgtaggaaaggttggc
agcgatgccgaaggagagatgctcgtcgaagatttcagaaagaggggagtggacttgtcg
ggaatagttaagagtgaagggaggagcggacaggcgctcatcttcgtcgataggaatgga
aacagagccatactcgtcgatcctggcgtgaacgatacgataaagttcgaggaggtaaac
aaagaattgatagaaaaagctgaaatcgtgcacatgacttcgttcatttgcaagaacggt
acggattccttggaaagtcagaagaaagtggcgaaggttgcgaaagctgtcagcttcgat
cccggcttgccttacgttgaaagaggtttggaagaaattagggaaatagtggagagaacg
acaatcctccttcctaacaagacggagatcgagaagctcgtgggaaaggatttcagagaa
gcggctaaagaaatgatcgaggagggcgtaaaagttgttgctgttaagctcggagaaaag
ggctgctacgttactgacggaaaagaagagcatttcatcgaggctttcaaagcgaacgtc
gtcgacactactggagccggcgacgctttcaacgctggctttctgtacggctggatgaaa
gggaagagcttggaggcttgcggaaagctcggaaattacgtcgcttcgaagatagtcgaa
agagtcggagctaggaactacgaaggaatcgatccagagaagtttgtttga

  All links  
No link information was found.   
DBGET integrated database retrieval system