KEGG   Ferroglobus placidus: Ferp_1241Help
Entry
Ferp_1241         CDS       T01172                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fpl  Ferroglobus placidus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ferp_1241
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ferp_1241
   00640 Propanoate metabolism
    Ferp_1241
   00660 C5-Branched dibasic acid metabolism
    Ferp_1241
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ferp_1241
Enzymes [BR:fpl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ferp_1241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1068553..1069698
Genome map
AA seq 381 aa AA seqDB search
MRLHEYQAKQIFAKYGIKIPKGKLATTVEEVRKIAEELGGKVVLKSQILVGGRGKAGGIK
LANSVEEAVEIAKDLFGKVIKGHRVEKIYVEEQLNIQREMYVGLTLDRAEKGIALIVSSV
GGMDIEEIAAKHPEKIARITINPLYGLWDFQIREVLYKSGMPKELHKEITGIIKALYKIL
IDHEAELTEINPLVLTDKGLFAADARLNVDDNALYRHPELKELRDYTEVDQIERIAEEKG
LNYVKLDGNIGVIANGAGMSMSTMDLIYLEGGKPANFLDIGGGASSEVVKEAIKTILMDK
NVKVIFMNIFGGITRCDEVAKGLVKAFQEIVIPVPIVLRLAGTNEEEGRRIIEEFLEREK
KNIIVVETMEEGAKKAVELAR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgcacgaatatcaggctaaacagatttttgctaaatacggaataaaaattcct
aagggtaaacttgctaccaccgtcgaagaggtaagaaagattgccgaagaacttggagga
aaagtcgttctcaaatcccaaatcctcgtcggaggaagaggaaaagccggaggaataaag
ctggctaacagcgttgaagaggctgttgaaatagcgaaggatctttttggaaaagttatc
aagggtcacagagttgagaaaatatacgtggaggagcagctaaacattcagagggagatg
tacgtaggcttaactttagatagagctgagaagggtatagctctgatagtcagcagcgtt
ggaggaatggacatagaagagatagcggcgaaacacccggagaagatagcgaggataacg
ataaaccccctctacggactctgggacttccagataagggaagtgctttacaaatcggga
atgcccaaggagcttcataaggaaatcaccggaataataaaagccctctacaagattctg
atcgaccacgaggctgagcttaccgaaattaacccgctcgttctcacggacaagggtctt
ttcgctgccgacgcaaggttaaacgttgacgataacgccctctacaggcatccagagctt
aaggagctgagagactacaccgaggtcgatcagatcgagaggatagctgaggagaaggga
ttgaactacgtcaagctcgacggaaacattggtgttatagcaaacggagccggaatgagc
atgtcaacgatggatctgatttacttggaaggaggaaagccggcaaacttcttagacatc
ggagggggagcgagcagcgaagtcgtgaaggaagcgataaagacaattctgatggataaa
aacgtgaaagtgatattcatgaacatcttcggaggtataacgaggtgcgacgaagttgcg
aaaggacttgttaaagcttttcaagaaatagtaattccagttcccatcgttttgagattg
gctgggactaacgaggaagagggaaggaggataatcgaagagtttcttgagagggagaaa
aagaacataatagttgtcgaaactatggaagagggtgcgaaaaaagctgttgaattagcg
aggtga

DBGET integrated database retrieval system