KEGG   Ferroglobus placidus: Ferp_1302Help
Entry
Ferp_1302         CDS       T01172                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
fpl  Ferroglobus placidus
Pathway
fpl00010  Glycolysis / Gluconeogenesis
fpl01100  Metabolic pathways
fpl01110  Biosynthesis of secondary metabolites
fpl01120  Microbial metabolism in diverse environments
fpl01130  Biosynthesis of antibiotics
fpl01200  Carbon metabolism
fpl01230  Biosynthesis of amino acids
Module
fpl_M00002  Glycolysis, core module involving three-carbon compounds
fpl_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferp_1302
Enzymes [BR:fpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Ferp_1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N NAD_binding_3 Semialdhyde_dh Sacchrp_dh_NADP GFO_IDH_MocA 2-Hacid_dh_C TrkA_N LTV
Motif
Other DBs
NCBI-ProteinID: ADC65456
UniProt: D3RY93
Position
complement(1120626..1121633)
Genome map
AA seq 335 aa AA seqDB search
MKVKVAVNGYGTIGKRVADAVNLQKDMEVVGVTKTKPDFEAKLAVKKGYKLYVAIPERIE
LFEKAEVKVEGTIDDLLEKVDVVVDCSPNKVGAENKPKYEKAGVKAIFQGGEKSHVAEVS
FNALANYDDARGKNFVRVVSCNTTGLARFISVVKSVADVKKVRATMIRRVVDPKEDKKGL
VNGIMPDPVRLPSHHAEDVKTVLPDVNIVTTAFKVPTTLMHVHGISIELDGKLEDIVAAL
EDEPRIMLISEEDGFTSTAKIIEYARELRMRYDIFENVVWRESLAIHEGELFAVQAIHQE
AIVVPENVDAIRAMFELADKEESMKLTNESLGIKK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttaaagtagctgtaaacgggtacggaacgattggaaagagagttgccgatgcc
gtgaacctgcagaaggacatggaagtagtcggagttacaaaaacgaagccggacttcgag
gcgaaacttgctgtgaaaaagggttacaagctctacgtagcgattccggaaagaatagag
ctgttcgagaaagcagaggtgaaagtggaagggacgatagacgacttgcttgagaaggtt
gacgttgttgttgactgctctccaaacaaggttggggctgagaacaagccgaaatacgaa
aaagctggagttaaggctattttccagggaggagagaagagtcacgttgctgaagtgtct
ttcaacgctctcgcgaactacgatgatgcgagaggtaagaacttcgtcagagtcgtgagc
tgcaacaccactggattggcgagattcatttcggtggttaaaagcgtagcagacgtgaag
aaggttagagcgacgatgataagaagagtcgtcgacccaaaggaggacaagaagggtctc
gttaacggaataatgccggatcccgtcaggcttccctctcaccacgcggaagacgttaaa
acagttttacctgacgttaacatagtcacgacagctttcaaagttccaacaactctcatg
cacgttcacggcatttccatagagctcgacggaaagctcgaagacatcgtcgcagcttta
gaagacgagccgaggataatgctgatttccgaggaagacggattcacgtccactgcgaag
ataatagagtacgcgagggagctgagaatgaggtacgacattttcgagaacgtggtttgg
agggagagcttggcaatccacgagggagagctttttgccgtgcaagcgattcatcaggag
gctatcgtcgttccagagaacgttgatgcgataagagcgatgttcgagctggctgacaag
gaggaaagcatgaagcttacgaacgagtccctcggaattaagaagtag

DBGET integrated database retrieval system