KEGG   Ferroglobus placidus: Ferp_1322Help
Entry
Ferp_1322         CDS       T01172                                 

Definition
pyridoxal-phosphate dependent TrpB-like enzyme
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fpl  Ferroglobus placidus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ferp_1322
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ferp_1322
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ferp_1322
Enzymes [BR:fpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ferp_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1135254..1136546
Genome map
AA seq 430 aa AA seqDB search
MRKILLDENEMPKEWYNILPDLPEDLPPPLNPATNEPVKPEELEAIFPKALIKQEMSQER
WIRIPEEVRDIYALWRPTPLIRAKRLEEYLKTPARIYFKYEGGSPPGSHKPNTAVAQAYY
NAKEGVERLTTETGAGQWGSALCFATKLFDLKCTVYMVKVSYHQKPYRRILMETWGGEVI
PSPSDRTESGRRILEKDPDNPGSLGIAISEAIEDAVKNEDTKYSLGSVLNHVLLHQTVIG
LEAKKQLESIGEEPDVIVGCVGGGSNFAGLSYPFVKDVEKRGTKIIAVEPAACPTLTKGE
YRYDFGDTAGLTPLLKMYTLGHDFIPPPIHAGGLRYHGDAPTLCILVKNGLVEARAVKQI
PTFEAGLIFARTEGIVPAPETNHAIRVVIDEAIKAREENEEKVILFGFSGHGLLDLKAYD
DFLSGKLQDV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatcctgttagatgagaatgagatgccgaaagagtggtacaacatactcccc
gatcttccggaagatttgccccctccgctaaacccagcaacgaacgagccggtgaagccg
gaagagctcgaagcaatctttccaaaagctttaataaagcaggagatgagccaggaaaga
tggataagaattccagaggaagtgagggacatttacgctctctggagaccgactccgctt
ataagagctaagaggctcgaagagtacttgaaaactcccgcaagaatttacttcaagtac
gaaggaggaagtccgccgggaagccacaaacctaatacggctgttgcccaggcgtattac
aacgctaaggagggtgttgaaaggcttacaaccgaaaccggagcgggacagtggggctct
gctttgtgcttcgctaccaaactttttgatttaaaatgtacggtttacatggttaaagtc
agctaccaccaaaaaccctacaggagaatactgatggaaacttggggaggagaagtaatt
ccgtctccgagcgacagaacggagagcggaagaagaatacttgagaaagatcccgacaac
ccgggaagtttgggaatagccataagcgaagcaatcgaggatgccgtaaaaaatgaggac
acgaagtacagcctcggaagcgttttaaatcacgttcttcttcaccagacggtaattgga
ctggaagcgaaaaaacagcttgaaagcataggtgaggagcctgacgtaatagttggatgc
gttggtggaggaagcaactttgccggattaagctatcccttcgtaaaagatgttgagaag
aggggaacgaagataatagctgtggagccagctgcgtgcccaacattaacgaaaggggaa
tacagatacgactttggagatacagccggattgacacctttgctgaaaatgtacaccctc
gggcacgactttatccctccgcctattcacgctgggggattaagataccacggagacgct
ccaaccttgtgcattctcgttaaaaacggattggtcgaagcgagagccgtgaagcagatt
cccacttttgaagccggattgatttttgcgagaacggagggaatagttccagctccagaa
acaaaccatgcgataagggttgtaatagacgaagcgatcaaagcgagggaggagaacgag
gagaaagtaatcttgtttggattcagcggacacggactgcttgatttgaaagcctacgac
gatttcctgagcggaaagcttcaggatgtgtga

DBGET integrated database retrieval system