KEGG   Ferroglobus placidus: Ferp_1322Help
Entry
Ferp_1322         CDS       T01172                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fpl  Ferroglobus placidus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ferp_1322
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ferp_1322
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ferp_1322
Enzymes [BR:fpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ferp_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1135254..1136546
Genome map
AA seq 430 aa AA seqDB search
MRKILLDENEMPKEWYNILPDLPEDLPPPLNPATNEPVKPEELEAIFPKALIKQEMSQER
WIRIPEEVRDIYALWRPTPLIRAKRLEEYLKTPARIYFKYEGGSPPGSHKPNTAVAQAYY
NAKEGVERLTTETGAGQWGSALCFATKLFDLKCTVYMVKVSYHQKPYRRILMETWGGEVI
PSPSDRTESGRRILEKDPDNPGSLGIAISEAIEDAVKNEDTKYSLGSVLNHVLLHQTVIG
LEAKKQLESIGEEPDVIVGCVGGGSNFAGLSYPFVKDVEKRGTKIIAVEPAACPTLTKGE
YRYDFGDTAGLTPLLKMYTLGHDFIPPPIHAGGLRYHGDAPTLCILVKNGLVEARAVKQI
PTFEAGLIFARTEGIVPAPETNHAIRVVIDEAIKAREENEEKVILFGFSGHGLLDLKAYD
DFLSGKLQDV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatcctgttagatgagaatgagatgccgaaagagtggtacaacatactcccc
gatcttccggaagatttgccccctccgctaaacccagcaacgaacgagccggtgaagccg
gaagagctcgaagcaatctttccaaaagctttaataaagcaggagatgagccaggaaaga
tggataagaattccagaggaagtgagggacatttacgctctctggagaccgactccgctt
ataagagctaagaggctcgaagagtacttgaaaactcccgcaagaatttacttcaagtac
gaaggaggaagtccgccgggaagccacaaacctaatacggctgttgcccaggcgtattac
aacgctaaggagggtgttgaaaggcttacaaccgaaaccggagcgggacagtggggctct
gctttgtgcttcgctaccaaactttttgatttaaaatgtacggtttacatggttaaagtc
agctaccaccaaaaaccctacaggagaatactgatggaaacttggggaggagaagtaatt
ccgtctccgagcgacagaacggagagcggaagaagaatacttgagaaagatcccgacaac
ccgggaagtttgggaatagccataagcgaagcaatcgaggatgccgtaaaaaatgaggac
acgaagtacagcctcggaagcgttttaaatcacgttcttcttcaccagacggtaattgga
ctggaagcgaaaaaacagcttgaaagcataggtgaggagcctgacgtaatagttggatgc
gttggtggaggaagcaactttgccggattaagctatcccttcgtaaaagatgttgagaag
aggggaacgaagataatagctgtggagccagctgcgtgcccaacattaacgaaaggggaa
tacagatacgactttggagatacagccggattgacacctttgctgaaaatgtacaccctc
gggcacgactttatccctccgcctattcacgctgggggattaagataccacggagacgct
ccaaccttgtgcattctcgttaaaaacggattggtcgaagcgagagccgtgaagcagatt
cccacttttgaagccggattgatttttgcgagaacggagggaatagttccagctccagaa
acaaaccatgcgataagggttgtaatagacgaagcgatcaaagcgagggaggagaacgag
gagaaagtaatcttgtttggattcagcggacacggactgcttgatttgaaagcctacgac
gatttcctgagcggaaagcttcaggatgtgtga

DBGET integrated database retrieval system