KEGG   Ferroglobus placidus: Ferp_1446Help
Entry
Ferp_1446         CDS       T01172                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
fpl  Ferroglobus placidus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ferp_1446
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ferp_1446
Enzymes [BR:fpl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Ferp_1446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1236259..1237458
Genome map
AA seq 399 aa AA seqDB search
MMEKIFERVESYRDFSVEVLSKLIEIKALSPENGGDGEYEKAEYVESLLENLKVRRYDAK
DDRVSSGVRPNIVAELEGEEKRRLWIVTHLDVVPEGDISLWESDPFKAVYKDGKVYGRGS
EDNGQSLVGSIIAAKALIDLEITPKLTLSLAFVSDEETGSRYGIQHLINLGVFRKDDLIL
VPDAGFPKGDKIEIAEKNILWLKITVLGKQGHASRPDLCKNANRKAMQLLVELDKELHKK
FSKRNDLFNPPYSTFEPTKREKNVDNINTIPGRDVSYIDCRILPEYKNEEVIEFVKEFVE
KRKEDFEVFVDVVQDESSPPTKEDSEIVQRLMRAIKVARNIDAKLCGIGGNTCAAFFRKA
GFETAVWSTTDGKAHEPNEYAKIDNLIEDAKVFALLPVL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgatggagaaaatttttgaaagagttgagagttacagagacttttccgtagaagttctt
tctaagctaatcgaaataaaagctctctctccagaaaacggaggggatggagagtacgaa
aaagctgaatacgtcgaatctctcctcgaaaacttaaaggttaggaggtacgacgctaag
gatgacagagtaagctctggagttcgacccaacatagtggctgagcttgagggggaagag
aagagaaggctctggatcgtcacgcacctcgatgtcgttccggagggagacatttctctg
tgggagagcgatccgttcaaagctgtttacaaggacggcaaagtctatggaagggggagc
gaagataacgggcagagcttggtcggttcgataatagctgctaaagctctgatagatctt
gaaatcactccaaagttaacattgtccttagccttcgtttccgatgaagagaccggaagc
aggtacggaattcagcatttaataaacttgggcgtttttcgcaaagacgatctaattctc
gtccccgacgccggttttccgaagggagataaaatagagattgcggagaaaaacatccta
tggttgaagattacggttttaggaaagcaaggacatgcgagcagacccgatttgtgtaaa
aatgcgaacagaaaggcaatgcagctgctcgtcgaactcgataaagagttgcataagaag
ttttctaagagaaacgacctgtttaaccctccttattctaccttcgagcctacgaagagg
gagaaaaatgtagataacataaacacgattccggggagagacgttagctacatagactgt
cgaattttgccggagtataagaacgaggaagtgatcgaattcgttaaagaattcgttgag
aaaagaaaggaagactttgaagttttcgtcgacgtagttcaggatgagagttcccctcca
acgaaagaagacagcgagatcgttcagagattgatgagggcgataaaagttgcgagaaat
atagatgccaagctttgcggaatcggagggaatacttgtgcagctttcttcagaaaagca
gggtttgaaacagctgtctggagcacgacggacggaaaagctcacgagccgaacgaatat
gcgaaaatagacaacctgatagaagacgccaaggttttcgctttgctgccagttttatga

DBGET integrated database retrieval system