KEGG   Ferroglobus placidus: Ferp_1532Help
Entry
Ferp_1532         CDS       T01172                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
fpl  Ferroglobus placidus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ferp_1532
   01230 Biosynthesis of amino acids
    Ferp_1532
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferp_1532
   00030 Pentose phosphate pathway
    Ferp_1532
   00051 Fructose and mannose metabolism
    Ferp_1532
  Energy metabolism
   00680 Methane metabolism
    Ferp_1532
Enzymes [BR:fpl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Ferp_1532
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Ferp_1532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1321316..1322428
Genome map
AA seq 370 aa AA seqDB search
MSKITVSLIKADVGSVAGHTTVADELIKIAENNLSEAKESGLIIDFRVFKAGDDLELLMT
HTKGVDNEEIHRLAWETFEKAAEKAKELKLYGAGQDLLADAFSGNVRGMGPGVAEMEFTE
RKAEPLIAFMMDKTEPGAFNLPIFRIFADPFNTAGLVIDPSMHQGFVFEIWDIMEHKRVF
MKAPEEMYDILALIGAKSRFVIKRVYPKPGGKLPEDEPVAVVSTEKLYQVAGEYVGKDDP
VALVRAQSGLPAVGEVLEAFAFPHLVSGWMRGSHNGPLMPVSFKYAKCTRFDGPPRVVAA
GFQLSNGKLIGPVDLFDDPAFDYTRQKAMEIAEYMRRHGPFEPHRLPREEMEYTTLPKVM
EKLKERFEEI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaataaccgtcagcctgataaaagcagatgtcggcagcgtagccggacacacg
actgttgctgacgaacttattaaaattgcggaaaacaacctttctgaggcaaaagaaagc
ggattgataattgatttcagggttttcaaagccggagacgatttggagcttttgatgacc
cacacgaagggcgtggataatgaagagatccacaggctcgcttgggaaacctttgaaaaa
gcggctgaaaaagcaaaagaactaaagctttacggggctggacaagatcttctagcagac
gcatttagcggaaacgtgaggggaatgggtcccggagtggcggaaatggagtttacggag
agaaaggctgagccgctcatagcgttcatgatggacaagactgagccgggagcgttcaac
cttccgatcttcaggattttcgcagatcccttcaacaccgctggattggtgatcgatccg
agcatgcatcagggcttcgtcttcgaaatctgggacataatggagcacaaaagagtgttc
atgaaagctccggaagagatgtacgacatcctcgctttaatcggagctaagagcaggttc
gttattaaaagagtttatcccaagcccggcggaaaacttccggaagacgagcctgttgct
gtggtaagcacggagaagctttatcaagtagccggagagtacgtgggaaaggacgacccg
gtagctctcgtcagagctcaaagcggtttaccggcggttggagaagttctcgaagcgttt
gctttcccacacttggtgagcggatggatgcgtggaagccacaacggtccgctaatgccg
gtatcgtttaaatacgctaagtgcacgaggttcgacggtccgccgagagttgtggcagcc
ggcttccagctttctaatggaaagcttattgggccagtagacttgttcgacgatccagct
ttcgactacacgagacagaaggctatggagatagccgaatacatgaggaggcacggacca
ttcgaaccgcatagattgccgagggaggaaatggagtacacgactttgccgaaagtcatg
gaaaaactcaaagaaagattcgaagaaatctaa

DBGET integrated database retrieval system