KEGG   Ferroglobus placidus: Ferp_1664Help
Entry
Ferp_1664         CDS       T01172                                 

Definition
glutamine synthetase
Orthology
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
fpl  Ferroglobus placidus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fpl01230]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:fpl00630]
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:fpl00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:fpl00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fpl00330]
Environmental Information Processing; Signal transduction; Two-component system [PATH:fpl02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1445302..1446744)
Genome map
AA seq 480 aa AA seqDB search
MEEEVRKILEENGVKQVLCAFTDVRGYLMTFSIPAREFIEGNTFDGIGFDGSSIRGFKTI
EQSDMVWMPDPKTLRVIPWENDPLQKSAIMFGDVYEAWAAEQADCDPRGYVAKRMEKQLK
DKGLSVIFGPEIEFFLFEKIDPTRLYWDLWVSPNGGAGDSWGPPRVMPESRELEAGWYVI
RPKEGYFRPPPEDTTVAYRNELVHYLEKLGIIVEYHHHEVATAGQVELDFKPMQLVDVSD
AFYLYKFAAKNVAALHGMMAVFMPKPLYLDNASGMHVHQSLWEGEPFKGKNIFADPDDEF
MLSQKARYYIGGLLEHAKALTALCAPTINSYKRLVPGFEAPIYICWSPRNRSALVRVPMY
HRKPSAIRVEYRGADPSTNPYLSLAAMVAAGLDGIKKKIDPGDPIMEDVYELSESQKREL
GIGELPTTLRDALDHLATDEVIQKVLGSHIFDAFMSIKIDEWNQYCLYITPWEIMKYLDI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggaagtgagaaagattttagaagagaacggcgtaaagcaagtgctctgcgct
tttacagatgtgagaggttatctcatgactttcagtattccagcgagagaattcatagaa
ggaaacactttcgacggaattggctttgacggatcatcgatcagaggtttcaaaacgata
gagcagagcgacatggtgtggatgccggatccgaagactttgagagtaataccgtgggaa
aacgaccctctgcaaaaatccgccataatgttcggagacgtttacgaggcttgggctgca
gagcaagctgattgcgatccgagaggatacgttgctaaaagaatggaaaagcaattaaaa
gataaaggtttgtccgtaattttcggtccggagatcgagttcttcctctttgaaaagata
gatccgacgagactttactgggacctctgggtttctccaaacggaggagccggagacagc
tggggtccgccgagggtaatgccagaaagcagagaacttgaagctggctggtacgtgata
agaccgaaggaaggatacttcagacctcctccagaagatacaaccgttgcatacagaaac
gagctcgttcactatttagaaaagcttggtataattgtagaataccaccaccacgaggta
gctacagccggacaggtcgaattggatttcaagccgatgcagcttgttgacgtaagcgac
gccttctacctctacaagttcgccgctaaaaacgtagctgccctccacggcatgatggct
gttttcatgccaaagccgctttacttggacaacgcaagcgggatgcacgttcaccagagt
ctctgggaaggagagccgttcaaaggtaagaacatcttcgctgatccggatgatgagttc
atgctgagccagaaagcgagatactacataggcggattgcttgagcatgctaaagcatta
acagctctatgcgccccaactataaacagctacaaaaggctcgtcccgggatttgaagcg
ccgatttacatttgctggagtccgaggaacagaagcgctctcgtgagagttcccatgtat
cacagaaagccatcagccataagagtcgagtacagaggagccgatccgagcacaaatccc
tacttgtctttagctgcaatggtcgcagcgggtttggacggaataaagaagaaaatcgat
cccggcgatccgataatggaagacgtttacgagttgagcgaaagtcagaagagagagctt
ggtataggagagctaccgacgacgttgagagatgctttggaccacttggcgacggacgaa
gttattcagaaagtcctcggctcccatatattcgatgcgttcatgagcattaaaatcgac
gaatggaaccagtactgcctctacataactccttgggaaattatgaaatacctcgacatc
tga

DBGET integrated database retrieval system