KEGG   Ferroglobus placidus: Ferp_1664Help
Entry
Ferp_1664         CDS       T01172                                 

Definition
glutamine synthetase
Orthology
K01915  
glutamine synthetase [EC:6.3.1.2]
Organism
fpl  Ferroglobus placidus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Glyoxylate and dicarboxylate metabolism
Nitrogen metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Two-component system
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ferp_1664
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ferp_1664
  Energy metabolism
   00910 Nitrogen metabolism
    Ferp_1664
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ferp_1664
   00330 Arginine and proline metabolism
    Ferp_1664
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ferp_1664
Enzymes [BR:fpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamate---ammonia ligase
     Ferp_1664
Exosome [BR:fpl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ferp_1664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1445302..1446744)
Genome map
AA seq 480 aa AA seqDB search
MEEEVRKILEENGVKQVLCAFTDVRGYLMTFSIPAREFIEGNTFDGIGFDGSSIRGFKTI
EQSDMVWMPDPKTLRVIPWENDPLQKSAIMFGDVYEAWAAEQADCDPRGYVAKRMEKQLK
DKGLSVIFGPEIEFFLFEKIDPTRLYWDLWVSPNGGAGDSWGPPRVMPESRELEAGWYVI
RPKEGYFRPPPEDTTVAYRNELVHYLEKLGIIVEYHHHEVATAGQVELDFKPMQLVDVSD
AFYLYKFAAKNVAALHGMMAVFMPKPLYLDNASGMHVHQSLWEGEPFKGKNIFADPDDEF
MLSQKARYYIGGLLEHAKALTALCAPTINSYKRLVPGFEAPIYICWSPRNRSALVRVPMY
HRKPSAIRVEYRGADPSTNPYLSLAAMVAAGLDGIKKKIDPGDPIMEDVYELSESQKREL
GIGELPTTLRDALDHLATDEVIQKVLGSHIFDAFMSIKIDEWNQYCLYITPWEIMKYLDI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggaagaggaagtgagaaagattttagaagagaacggcgtaaagcaagtgctctgcgct
tttacagatgtgagaggttatctcatgactttcagtattccagcgagagaattcatagaa
ggaaacactttcgacggaattggctttgacggatcatcgatcagaggtttcaaaacgata
gagcagagcgacatggtgtggatgccggatccgaagactttgagagtaataccgtgggaa
aacgaccctctgcaaaaatccgccataatgttcggagacgtttacgaggcttgggctgca
gagcaagctgattgcgatccgagaggatacgttgctaaaagaatggaaaagcaattaaaa
gataaaggtttgtccgtaattttcggtccggagatcgagttcttcctctttgaaaagata
gatccgacgagactttactgggacctctgggtttctccaaacggaggagccggagacagc
tggggtccgccgagggtaatgccagaaagcagagaacttgaagctggctggtacgtgata
agaccgaaggaaggatacttcagacctcctccagaagatacaaccgttgcatacagaaac
gagctcgttcactatttagaaaagcttggtataattgtagaataccaccaccacgaggta
gctacagccggacaggtcgaattggatttcaagccgatgcagcttgttgacgtaagcgac
gccttctacctctacaagttcgccgctaaaaacgtagctgccctccacggcatgatggct
gttttcatgccaaagccgctttacttggacaacgcaagcgggatgcacgttcaccagagt
ctctgggaaggagagccgttcaaaggtaagaacatcttcgctgatccggatgatgagttc
atgctgagccagaaagcgagatactacataggcggattgcttgagcatgctaaagcatta
acagctctatgcgccccaactataaacagctacaaaaggctcgtcccgggatttgaagcg
ccgatttacatttgctggagtccgaggaacagaagcgctctcgtgagagttcccatgtat
cacagaaagccatcagccataagagtcgagtacagaggagccgatccgagcacaaatccc
tacttgtctttagctgcaatggtcgcagcgggtttggacggaataaagaagaaaatcgat
cccggcgatccgataatggaagacgtttacgagttgagcgaaagtcagaagagagagctt
ggtataggagagctaccgacgacgttgagagatgctttggaccacttggcgacggacgaa
gttattcagaaagtcctcggctcccatatattcgatgcgttcatgagcattaaaatcgac
gaatggaaccagtactgcctctacataactccttgggaaattatgaaatacctcgacatc
tga

DBGET integrated database retrieval system