KEGG   Ferroglobus placidus: Ferp_1749Help
Entry
Ferp_1749         CDS       T01172                                 

Definition
tetrahydromethanopterin S-methyltransferase (EC:2.1.1.86)
Orthology
K00584  
tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
fpl  Ferroglobus placidus
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ferp_1749
  Energy metabolism
   00680 Methane metabolism
    Ferp_1749
Enzymes [BR:fpl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Ferp_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1517348..1518298
Genome map
AA seq 316 aa AA seqDB search
MFCVESKVVEIGGIKIGGKGENPVVLVGTMFYTGHKIVEKRKEGKFDRKKAEELINMQET
LSEETGIPSMLDIVALSEEEFKKYIDFVAEVTEMPFMIDAWKIPPKIGAAKYVKEIGLED
RVVYNSLSPWSEDLEKEVNELREIGLKHGLTVAYNMNDPSVEGRIRILKETLLPALEKAG
FENILIDTSVLNTPSIALSLLACKKIKEVFGHPVGCAPSNGTDVWKYPREKWGKLGFAAV
DSAAHAITALLWNDFILYGAIENAKWVFPAVATANSILATFIYDEVGKLPEGEHPLNKLF
PEFVEQLGAVKCGNRS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgttttgcgttgaatcgaaagtagttgagatcggtggaatcaagattggggggaagggg
gaaaatccggtagtcttagtgggaacgatgttttacaccggacacaagatagtggagaaa
aggaaggaagggaagttcgacaggaaaaaggctgaggagctgataaacatgcaggaaact
ctgagcgaagaaaccgggattccgtccatgctcgatatagtcgctctgtccgaggaagag
tttaagaagtacatagatttcgtggctgaagtgacggaaatgccgttcatgatagatgct
tggaaaattccaccaaagataggggctgctaaatacgtgaaggaaataggtctggaggat
agagtagtttacaactccttatctccttggagcgaggatttggagaaggaggttaacgaa
cttagagaaattgggctgaagcacggtttgacagttgcatacaacatgaacgatccgagt
gttgaggggaggataagaattctaaaggagacgctcctcccagctttggaaaaagccgga
ttcgaaaacattctcattgacacatccgttttgaacactccttcgatagctctttctctc
ttagcctgtaaaaagattaaggaggtgttcggacatccggttggttgcgccccttcaaac
ggcacggatgtttggaagtatccgagggaaaagtggggcaaactcggtttcgcagctgta
gatagcgcagctcatgcgataacagctttgctatggaacgacttcatactctacggagcg
atagaaaatgcgaagtgggttttcccagctgtagcaacagccaactcaattctggcgacc
ttcatatacgatgaagttggcaaactgcctgaaggagagcatccgctgaacaaactcttc
cccgagtttgtggagcagctaggggcagtaaaatgtggaaatcgatcataa

DBGET integrated database retrieval system