KEGG   Ferroglobus placidus: Ferp_1749Help
Entry
Ferp_1749         CDS       T01172                                 

Definition
tetrahydromethanopterin S-methyltransferase (EC:2.1.1.86)
Orthology
K00584  
tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
fpl  Ferroglobus placidus
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:fpl01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:fpl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1517348..1518298
Genome map
AA seq 316 aa AA seqDB search
MFCVESKVVEIGGIKIGGKGENPVVLVGTMFYTGHKIVEKRKEGKFDRKKAEELINMQET
LSEETGIPSMLDIVALSEEEFKKYIDFVAEVTEMPFMIDAWKIPPKIGAAKYVKEIGLED
RVVYNSLSPWSEDLEKEVNELREIGLKHGLTVAYNMNDPSVEGRIRILKETLLPALEKAG
FENILIDTSVLNTPSIALSLLACKKIKEVFGHPVGCAPSNGTDVWKYPREKWGKLGFAAV
DSAAHAITALLWNDFILYGAIENAKWVFPAVATANSILATFIYDEVGKLPEGEHPLNKLF
PEFVEQLGAVKCGNRS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgttttgcgttgaatcgaaagtagttgagatcggtggaatcaagattggggggaagggg
gaaaatccggtagtcttagtgggaacgatgttttacaccggacacaagatagtggagaaa
aggaaggaagggaagttcgacaggaaaaaggctgaggagctgataaacatgcaggaaact
ctgagcgaagaaaccgggattccgtccatgctcgatatagtcgctctgtccgaggaagag
tttaagaagtacatagatttcgtggctgaagtgacggaaatgccgttcatgatagatgct
tggaaaattccaccaaagataggggctgctaaatacgtgaaggaaataggtctggaggat
agagtagtttacaactccttatctccttggagcgaggatttggagaaggaggttaacgaa
cttagagaaattgggctgaagcacggtttgacagttgcatacaacatgaacgatccgagt
gttgaggggaggataagaattctaaaggagacgctcctcccagctttggaaaaagccgga
ttcgaaaacattctcattgacacatccgttttgaacactccttcgatagctctttctctc
ttagcctgtaaaaagattaaggaggtgttcggacatccggttggttgcgccccttcaaac
ggcacggatgtttggaagtatccgagggaaaagtggggcaaactcggtttcgcagctgta
gatagcgcagctcatgcgataacagctttgctatggaacgacttcatactctacggagcg
atagaaaatgcgaagtgggttttcccagctgtagcaacagccaactcaattctggcgacc
ttcatatacgatgaagttggcaaactgcctgaaggagagcatccgctgaacaaactcttc
cccgagtttgtggagcagctaggggcagtaaaatgtggaaatcgatcataa

DBGET integrated database retrieval system