KEGG   Ferroglobus placidus: Ferp_1769Help
Entry
Ferp_1769         CDS       T01172                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fpl  Ferroglobus placidus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ferp_1769
Enzymes [BR:fpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Ferp_1769
Exosome [BR:fpl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ferp_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1532320..1533285
Genome map
AA seq 321 aa AA seqDB search
MEFPKLRMRRLRKDKIRPLLKETKLSAEDLIMPIFVDENISSPKEIPSMPGYFRLPIDGA
VKEVGEALEKGIRAFIFFGIPSYKDEIGSSAFDDNGVIQKTLRKVKKDYEDAVLITDVCL
CEYTTHGHCGVVKDKVILNDPTLPILGKIAVSHAKAGADIVAPSGMMDGMVKAIREALDE
NGFEDVAIMSYSAKYASSFYGPFREAAESGYAFGDRKSYQMDIHNSDEALREVELDLKEG
ADIVMVKPALAYLDIIWRVKEKFKVPVAAYNVSGEYSMVKAAAKLGFLKEEDIVYEILVS
IKRAGADLILTYHAKEIAEVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttggagtttccaaagctgagaatgaggaggttgagaaaagacaaaatccgtcctcttctg
aaagaaacgaaattgtctgctgaagatcttataatgcccatcttcgtcgacgaaaacatc
tcttctcccaaggaaattccctccatgccaggctacttcagacttcccattgacggagcc
gtgaaggaagtcggggaagctctcgagaagggaatcagagctttcatatttttcggaatt
ccctcctacaaagacgaaatcggctcttcagccttcgacgataacggagttatacagaag
acgttgagaaaagtgaagaaggattatgaagatgctgttttaataacggacgtttgcttg
tgcgagtacacgactcatggacattgcggagttgtaaaggacaaggtaattttgaacgac
ccaactctgccgattctcggaaagatagctgtgagccacgctaaagctggagctgacata
gttgctccctccggaatgatggacgggatggtcaaggctataagagaagctttggacgaa
aacggatttgaggatgttgccataatgagttactccgctaaatacgcctcttcgttctac
ggaccttttagagaagctgctgaaagtggatacgctttcggagacaggaaaagctatcag
atggacattcacaactccgacgaggctttgagggaagtggagctcgacttaaaggaagga
gccgacatagtgatggtcaaaccagctttggcttacctcgacataatttggagagtaaaa
gaaaaattcaaagttcccgtggcagcttacaacgtcagcggggagtattcaatggttaaa
gctgcagcaaaacttggttttttgaaggaagaggacatagtttacgagattctcgtctcg
attaaaagggctggggctgatttgattctaacttatcacgcgaaagaaatagcggaggtt
ttgtag

DBGET integrated database retrieval system