KEGG   Ferroglobus placidus: Ferp_1823Help
Entry
Ferp_1823         CDS       T01172                                 

Definition
thiamine pyrophosphate protein domain protein TPP-binding protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
fpl  Ferroglobus placidus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ferp_1823
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferp_1823
   00020 Citrate cycle (TCA cycle)
    Ferp_1823
   00620 Pyruvate metabolism
    Ferp_1823
   00640 Propanoate metabolism
    Ferp_1823
   00650 Butanoate metabolism
    Ferp_1823
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ferp_1823
   00680 Methane metabolism
    Ferp_1823
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ferp_1823
Enzymes [BR:fpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ferp_1823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1580215..1581051)
Genome map
AA seq 278 aa AA seqDB search
MILPGNASCHGCPITIAMKALDEVENPVVLMPASCSTVIAGIHPNSALKLPVVHVPFPST
PSVAAGMSRGYRKLGIKANVIAWMGDGAADISFAALKAVAERNEDVMVVVVDNEAFMNTG
NQSSSSTPKYAKTTTDPAGKRENKRSVSLALIDYGYVATASVGYIRDLRRKMRKAGEKEG
FRLLHIHCPCPPGWKFEAELTVEIARLAVQSLFWILWEKDSKFRISEISKKAYENRIPAE
KYIKLQGRFRGIRKEEIEELEKSAVEEFEKLLKLEEVL
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgattcttccgggaaacgcgagctgtcacggatgcccgattacgatagcgatgaaagct
ctcgatgaagttgagaacccggtggtgctaatgccggcaagttgctcgaccgttatagct
ggaattcatccgaattcggctttaaagcttccagtggttcacgttccgttcccttccact
ccttcggttgcggctggaatgagcagaggttacagaaagctcggaattaaagctaacgtg
atagcttggatgggagatggagcagcagatatcagctttgcagctctaaaagctgttgca
gagagaaacgaggacgtgatggttgttgttgtcgacaacgaagctttcatgaacaccgga
aaccagagcagttcttcgacgccaaaatacgcgaaaactacaaccgacccagccggaaag
agggagaataagaggagcgtttctctggctttgatcgactacggctacgtagctacagct
tcagtaggatatataagagacttgaggaggaaaatgaggaaagccggagaaaaagaggga
tttagacttcttcacatccactgcccgtgccctcccggctggaagtttgaagcagagtta
acggtggaaatagcgaggcttgccgttcaatctctgttctggattttgtgggaaaaggat
agcaagtttagaatatctgaaataagcaaaaaagcttacgaaaacagaattccagcggaa
aagtacataaaacttcagggaagatttagaggaataagaaaagaagaaatcgaagagctc
gaaaaaagcgctgtcgaggagttcgaaaaactgttaaaactggaggaggtgttatga

DBGET integrated database retrieval system