KEGG   Ferroglobus placidus: Ferp_1825Help
Entry
Ferp_1825         CDS       T01172                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
fpl  Ferroglobus placidus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:fpl01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fpl00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:fpl00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:fpl00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:fpl00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:fpl00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:fpl00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:fpl00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1582118..1582369)
Genome map
AA seq 83 aa AA seqDB search
MLDPLISHPKKGSAGKTGEWRVFKPIVDHELCVLCLECHEYCPENVIEVRDGRIWIDYDY
CKGCLVCKNVCKMKAIKAEREFY
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccctctcatctctcatcccaaaaaaggatcggcgggaaaaactggagagtgg
agggtttttaagccgatagtagatcacgagctttgcgttctatgcttggaatgccacgag
tactgtccagagaatgtgatagaggttagagacggtagaatctggatagattacgactac
tgcaaggggtgtttggtatgcaaaaacgtctgcaagatgaaagctataaaagcggaaaga
gagttttattaa

DBGET integrated database retrieval system