KEGG   Ferroglobus placidus: Ferp_1826Help
Entry
Ferp_1826         CDS       T01172                                 

Definition
pyruvate/ketoisovalerate oxidoreductase, subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
fpl  Ferroglobus placidus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ferp_1826
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferp_1826
   00020 Citrate cycle (TCA cycle)
    Ferp_1826
   00620 Pyruvate metabolism
    Ferp_1826
   00640 Propanoate metabolism
    Ferp_1826
   00650 Butanoate metabolism
    Ferp_1826
  Energy metabolism
   00680 Methane metabolism
    Ferp_1826
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ferp_1826
Enzymes [BR:fpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ferp_1826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1582363..1582857)
Genome map
AA seq 164 aa AA seqDB search
MIEVKIVSRGGQGGVTAARILAKAAMEEGLYSQAIPQFGAERRGAKVYSYLRIDEKPIRR
HTKVEKPRIVAYFDKKLVENDEAEIRILNGIAEGFCCLNANKIAEELDLISSGWYLLSSP
MSGAIARVLEISLNSLVYAVRSEFSSKVEENVLAAKKGYEVVKC
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagtcaagattgttagcagaggggggcagggaggagtaacagctgcaagaatt
ctcgccaaagcggcaatggaagaaggattgtattctcaggcgattccccaattcggagcg
gagaggagaggagccaaagtttactcttacctgagaattgacgaaaaaccgataagaaga
catacaaaggtggaaaagccgagaatcgtagcttattttgataaaaagctcgttgaaaat
gacgaagcggaaatcaggattttgaacggaattgcagaaggtttctgctgtttaaacgct
aataaaatagctgaagaactcgacttgatttcttctggctggtacctattaagttccccg
atgagcggagcgattgcaagagttttggagatcagtttgaacagtttggtgtacgcggta
aggagcgagttctcctctaaggttgaagaaaacgtccttgctgcgaaaaagggttacgag
gtggttaaatgttag

DBGET integrated database retrieval system