KEGG   Ferroglobus placidus: Ferp_1976Help
Entry
Ferp_1976         CDS       T01172                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fpl  Ferroglobus placidus
Brite
Enzymes [BR:fpl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Ferp_1976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Ubie_methyltran Methyltr_RsmB-F GCD14 Fibrillarin RrnaAD Methyltransf_3 CMAS Methyltransf_24 Methyltransf_23 DUF938 Methyltransf_11 MTS Methyltransf_32 Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: ADC66113
UniProt: D3S050
Position
1710324..1710971
Genome map
AA seq 215 aa AA seqDB search
MDEYFERRRRMVEKLKEELNISDRVAEAMLKVPRHLFVPPEYRREAYNDYPLPIGYDQTI
SAPHMVAIMCELLDLKEGMKVLEIGTGSGYHAAVVAELVGKRGKVITVERIPELAKRAEK
TLKELGYDNVIVVVGDGSEGYEKEAPYDRIYVTATAPDVPPPLIEQLKEGGKMVIPIGNF
SQYLYLIEKKKGKIEKRNMGPVRFVPLIGKFGFKD
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggacgagtactttgaaagaaggaggaggatggtagagaaattgaaggaggagctgaac
ataagcgatagggtagctgaagctatgctaaaagttcctcgccacctttttgttccgccc
gaatacagaagagaagcttacaacgactatcctttgccgataggctacgatcagactata
agcgctcctcacatggttgcgataatgtgcgagcttcttgatttgaaagaaggaatgaag
gtgcttgagatcggcacaggaagcggatatcatgcggctgtcgttgccgagctcgtggga
aagaggggaaaggtaataaccgtagagagaattcccgagctcgctaagagagctgaaaaa
acgcttaaagagctcggatacgataacgttatcgttgttgttggggatgggagcgaaggt
tacgaaaaagaagctccctacgacagaatttacgttacagccacagccccagacgttcct
cctccgctcatcgagcagcttaaggaaggaggaaagatggtgattcccatcggcaacttt
agccagtacttgtatttgatcgaaaagaaaaaggggaaaatagagaagaggaacatgggt
cctgttaggttcgttcccctcataggcaagttcggtttcaaggattga

DBGET integrated database retrieval system