KEGG   Ferroglobus placidus: Ferp_1999Help
Entry
Ferp_1999         CDS       T01172                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fpl  Ferroglobus placidus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ferp_1999
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ferp_1999
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ferp_1999
Enzymes [BR:fpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ferp_1999
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1730939..1732096
Genome map
AA seq 385 aa AA seqDB search
MKFGEFGGMYVPETLIAPLKELEKSYEKIKADEQFWNEFHFYLKNYAGRPTPLYYARNLS
KKIGGAKIYLKREDLLHSGAHKINNTIGQALLAKRMSKSRLIAETGAGQHGVATAIAGAL
FGMKVDIYMGAEDVRRQKMNVFRMKLLGANVIAVEGGSRTLKDAINEALRDWVSSFEYSH
YLIGSVVGPHPYPTIVRDFQSVIGKETREQIIEAEGRLPDLIVACVGGGSNAIGIFHEFL
NEKVKLVGVEAAGKGLNSGKHSASLCAGKKGVLHGMLSYFLQDEDGQIKDTHSIAAGLDY
PGVGPEHAWLKESGRAEYVAVNDEEALKAFVELSKTEGILPALESAHAVAYAMKAAEEMS
RDEIIVVNLSGRGDKDLEIVMGALK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattcggagaatttggcggaatgtacgttcccgaaactctgatagctccgttgaaa
gagcttgaaaaatcttacgaaaaaataaaggctgacgaacagttttggaatgaattccat
ttttacctaaaaaactacgccggaagaccgacacccctttactacgcgagaaatctgagc
aagaagataggaggggcgaaaatataccttaaaagggaagatcttcttcacagcggggct
cacaagataaacaacactatagggcaggctttgttggctaagcgtatgagcaagtcaaga
cttatcgccgaaacgggagccggacagcacggagttgccactgcgatagcgggagctttg
ttcggaatgaaggtggacatttacatgggagctgaagacgtaaggaggcagaagatgaac
gttttccgcatgaagctcctcggggctaatgtgatagccgtagaggggggaagcagaact
ttgaaggacgcgataaacgaagctcttagagactgggtttcgagtttcgagtactctcat
tatttaataggctcggtcgtaggacctcacccgtatccgacgatcgtaagggactttcag
tcggtgatagggaaagaaaccagagagcaaataattgaagcggaaggtcgcttgccggat
ttgattgttgcttgcgtcggaggtggaagcaatgcgatagggatttttcacgagtttcta
aacgagaaagtaaaacttgtaggggttgaagcagccggaaagggtttgaatagcggaaaa
cattcagcttcgctttgcgcaggaaaaaaaggagtgctgcacggaatgctttcatacttc
cttcaggacgaagacgggcagattaaagatacgcacagcatcgcagccggtttagattac
ccaggagtcggtccggagcatgcgtggcttaaagaaagtggaagagcggagtacgttgca
gtgaatgatgaagaagctttaaaagcctttgtcgaactctcaaagaccgagggaattctg
cctgctttagaatctgctcacgccgttgcctacgcgatgaaagccgctgaggaaatgagc
agggatgagataatagttgttaatctctcaggaagaggggataaggatctcgagatagtt
atgggggctttgaaatga

DBGET integrated database retrieval system