KEGG   Ferroglobus placidus: Ferp_2000Help
Entry
Ferp_2000         CDS       T01172                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fpl  Ferroglobus placidus
Pathway
fpl00260  Glycine, serine and threonine metabolism
fpl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fpl01100  Metabolic pathways
fpl01110  Biosynthesis of secondary metabolites
fpl01130  Biosynthesis of antibiotics
fpl01230  Biosynthesis of amino acids
Module
fpl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ferp_2000
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ferp_2000
Enzymes [BR:fpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ferp_2000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth FMN_dh PcrB ThiG NanE TMP-TENI NMO BtpA Ribul_P_3_epim IMPDH
Motif
Other DBs
NCBI-ProteinID: ADC66137
UniProt: D3S074
Position
1732093..1732848
Genome map
AA seq 251 aa AA seqDB search
MIKKPALITFITAGDPNIDATLEFMLVLEKYADVIELGVPFSDPMADGRTIQKANYRALK
SGTRIKDVFKVVEEFREHSSKPVVLMTYYNPVYRFGAENFIAEAKKSGVDGLIVVDLPIE
EAKEYVEICRKLEIGTIFLAAPNTPDERLKMIDEASSAFVYLISLYGTTGSRSEIPESAF
SLLSRAKRICRKPVAVGFGVSKAEHVKTLVEAGADGVVVGSAIVEIVEKFGENASEEIER
KVRELRSGLQL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaccggctttaataactttcataaccgccggcgatccaaatatcgatgca
actctcgaattcatgctcgttctggagaaatatgctgacgtaatagagctcggagttcct
tttagcgatccgatggcagacggaaggacgattcaaaaagcaaattacagagctttaaag
tcgggaacgagaattaaagatgttttcaaagtggtagaagagttcagggaacattcaagc
aaaccggtcgttttgatgacctactacaatcccgtttacaggttcggagcggagaatttc
attgctgaagcgaagaaatcgggagttgatggtctaattgtagtcgatctgccgattgag
gaggctaaagagtacgtcgaaatttgcagaaagctggagataggcacgatattcttggct
gctccaaacactccagatgaaagacttaagatgatagatgaagcaagttcagccttcgtc
tacttaatttctctctacggaacaaccggatcgagaagtgagattccggaaagtgccttt
agcttgctttcgagggctaagagaatttgtagaaagccagtagctgttggcttcggcgtt
tcaaaagcggagcatgtgaaaacgcttgtggaggctggagctgacggagttgtcgttggt
agtgcgatcgtggagattgtagaaaagttcggtgaaaacgcttcggaagagattgagaga
aaagtcagagaacttagaagtggtctccagctttaa

DBGET integrated database retrieval system