KEGG   Ferroglobus placidus: Ferp_2000Help
Entry
Ferp_2000         CDS       T01172                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fpl  Ferroglobus placidus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ferp_2000
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ferp_2000
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ferp_2000
Enzymes [BR:fpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ferp_2000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1732093..1732848
Genome map
AA seq 251 aa AA seqDB search
MIKKPALITFITAGDPNIDATLEFMLVLEKYADVIELGVPFSDPMADGRTIQKANYRALK
SGTRIKDVFKVVEEFREHSSKPVVLMTYYNPVYRFGAENFIAEAKKSGVDGLIVVDLPIE
EAKEYVEICRKLEIGTIFLAAPNTPDERLKMIDEASSAFVYLISLYGTTGSRSEIPESAF
SLLSRAKRICRKPVAVGFGVSKAEHVKTLVEAGADGVVVGSAIVEIVEKFGENASEEIER
KVRELRSGLQL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaccggctttaataactttcataaccgccggcgatccaaatatcgatgca
actctcgaattcatgctcgttctggagaaatatgctgacgtaatagagctcggagttcct
tttagcgatccgatggcagacggaaggacgattcaaaaagcaaattacagagctttaaag
tcgggaacgagaattaaagatgttttcaaagtggtagaagagttcagggaacattcaagc
aaaccggtcgttttgatgacctactacaatcccgtttacaggttcggagcggagaatttc
attgctgaagcgaagaaatcgggagttgatggtctaattgtagtcgatctgccgattgag
gaggctaaagagtacgtcgaaatttgcagaaagctggagataggcacgatattcttggct
gctccaaacactccagatgaaagacttaagatgatagatgaagcaagttcagccttcgtc
tacttaatttctctctacggaacaaccggatcgagaagtgagattccggaaagtgccttt
agcttgctttcgagggctaagagaatttgtagaaagccagtagctgttggcttcggcgtt
tcaaaagcggagcatgtgaaaacgcttgtggaggctggagctgacggagttgtcgttggt
agtgcgatcgtggagattgtagaaaagttcggtgaaaacgcttcggaagagattgagaga
aaagtcagagaacttagaagtggtctccagctttaa

DBGET integrated database retrieval system