KEGG   Ferroglobus placidus: Ferp_2128Help
Entry
Ferp_2128         CDS       T01172                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fpl  Ferroglobus placidus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ferp_2128
   01230 Biosynthesis of amino acids
    Ferp_2128
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferp_2128
   00051 Fructose and mannose metabolism
    Ferp_2128
   00562 Inositol phosphate metabolism
    Ferp_2128
Enzymes [BR:fpl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ferp_2128
Exosome [BR:fpl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ferp_2128
  Exosomal proteins of bladder cancer cells
   Ferp_2128
  Exosomal proteins of melanoma cells
   Ferp_2128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1837535..1838203)
Genome map
AA seq 222 aa AA seqDB search
MEKKVVIINFKAYREGAGKNALELAKAVEKVAEKSDFYFGVAPNFLDLAEIVKSVGIDVY
AQHVDAVEFGSHTGRITAEMIKEKGAKGSLINHSERRLRLADIDFLVSKFKELGLISVVC
TNNVSTTAAAAALSPDFVAVEPPELIGSGIPVSKAEPEVVENSVRAAKNVNEEVKVLCGA
GITKYEDVVAAIDLGADGVLLASGVVKASDPRKALEELVGLR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaaagttgtgataataaattttaaggcgtatagggagggagccggaaaaaac
gcgttggaattggctaaggctgttgaaaaagtggctgaaaaatctgatttctatttcgga
gtagctccaaactttttggatcttgctgagatcgtaaagagtgttggaatagacgtctac
gctcagcacgtagatgctgtcgagttcggaagtcacacgggaagaattaccgcggagatg
attaaggagaagggagcgaagggaagcttgataaaccacagcgagagaaggctgaggctt
gccgacatagacttcctcgtctccaaattcaaagagctcggtttaatttcagtcgtttgc
accaacaacgtttccacaactgcagcagcggcagctctttctccggacttcgtggctgta
gagccgccggaattaatcggaagcggcattccggtgagtaaagcggagccggaagtagtt
gaaaattccgtaagagctgctaaaaacgttaacgaagaagtgaaagttctgtgcggagcg
ggaataaccaagtacgaagacgttgtggctgccatagacctcggagctgacggagttttg
ctcgcaagcggagttgtaaaagcgagcgaccccagaaaagcgcttgaggagcttgtgggg
ctgagatga

DBGET integrated database retrieval system