KEGG   Ferroglobus placidus: Ferp_2213Help
Entry
Ferp_2213         CDS       T01172                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fpl  Ferroglobus placidus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ferp_2213
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ferp_2213
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ferp_2213
Enzymes [BR:fpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ferp_2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1914716..1915930)
Genome map
AA seq 404 aa AA seqDB search
MKVVGLKCRICGKEFPAEALYTCDNCFGPLEVVYDWEWIKENVSKEKIEKGPKTLWRYKD
FLPVEAEPVDLGAGYTRFIKAENLGEVLGLKNLYLLDDSTNPTYSFKDRVVSVAVTKAKE
FGMKALGCASTGNLAGSLAAHAAKAKLPAYIFVPAGIEKNKIIQALVHGAKVIEVEGTYD
DANRLATEVAEEHPDWGFVNINLRPYYAEGSKTLAYETAERLGWELPDQVVVPMASGALL
CAIHRGFKDLIRVGLVDEKDVVFNGCQPEGFPIVRAVKEGKPVTPIREIKTIVHSLAIGN
PADGIFAKEIIEKSGGYAEDPSDLEVIEAVKLLAKTEGIFTELAGGVTVAGLKRLVEEGR
IDKSDVVVIYLTGNGLKTSEALVDYLETTVRIKPRLEEFEEVVA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggtggggcttaagtgcagaatttgcggcaaggagtttccggctgaagctttg
tacacttgcgataactgttttggtcctttagaagtcgtgtacgactgggagtggattaag
gaaaacgttagcaaggaaaagatagaaaaaggtccgaaaactctctggaggtacaaggac
tttctccccgttgaagctgagcctgtggatctcggggctggatacacgaggttcataaaa
gctgaaaacctcggagaagtcctcggcttgaaaaacctctacctgttagacgactcaacg
aacccaacttactcgttcaaagacagagttgtgagcgttgccgtgacgaaggctaaggag
tttggaatgaaagccctcggctgcgcctctactggcaacctggctggaagcttggctgct
cacgctgcgaaggcaaaattgccagcatacatcttcgtacctgctggaattgagaagaac
aagataatacaggctttggttcacggggctaaggttatcgaagtggaaggcacctacgac
gacgctaacagattggcaacggaagttgctgaggagcatccggactggggattcgtgaac
ataaacctccgcccctactatgccgaggggagtaagacgttggcttacgaaactgccgaa
agattggggtgggagcttccggatcaagtggttgtgccgatggcttcaggagctttgctt
tgcgcaatacacagaggtttcaaagacttgataagggtcggactcgtagatgagaaagat
gtcgtattcaacggatgtcagcctgagggatttccgatagttagggctgtgaaggaaggg
aagccggtaacgcctataagagagattaaaacaatcgtccacagcttggcaataggcaat
ccggcagatggaatcttcgctaaggagataatagaaaagagcggtggttacgctgaagat
cccagcgatttagaggtaattgaagcggttaagctacttgcgaagaccgaaggaatattc
accgaacttgccggaggagtaaccgttgctggattgaaaaggttggtcgaagaggggaga
attgataaaagtgatgtcgtcgttatatacttgacggggaatgggttgaagacatccgaa
gctttggtggattacctcgaaacgacggtgagaataaagccgagactcgaagaatttgag
gaggtggtggcttga

DBGET integrated database retrieval system