KEGG   Ferroglobus placidus: Ferp_2262Help
Entry
Ferp_2262         CDS       T01172                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
fpl  Ferroglobus placidus
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:fpl00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1949980..1950549
Genome map
AA seq 189 aa AA seqDB search
MIEEAIKIGKKLAAYGLIDGASGNLSFRKGGKIVITKTGVVLDELTEEDFVEVEIGKKED
EASSDLYVHERIYEETDYKAVLHCHGVYGVTLSLFFDEIIPLDLEGKMFIGNLKIVEGRF
GSPSLAEKIAKSVKEKGICLVRGHGIYAAGENFDEAFKLASYLEHSCQILFNYEVFRRVL
ANPYHACRQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagaagcaattaaaattggaaagaagctcgctgcttacgggttaatagacggt
gcgagcggaaatttgagctttagaaaaggtggaaaaatagtaataacgaaaaccggagtt
gttctggacgagttaacggaagaggacttcgttgaagtggaaatcggaaagaaggaggat
gaggcttcttcggatttgtacgtgcacgagagaatttacgaagaaaccgactataaagct
gttctccactgccacggagtttacggagttactctctccttattcttcgacgagataatc
cccttagatctggaaggaaaaatgtttattggcaatcttaaaatcgttgagggaagattt
ggctccccctccttagctgagaaaattgcgaaaagtgttaaagagaagggaatatgcttg
gttagaggacacggcatttatgcagctggcgagaattttgacgaagctttcaaacttgca
agctatttagagcattcctgccaaatcctcttcaactacgaggttttccgtagagttctt
gcaaatccttaccacgcttgtaggcagtga

DBGET integrated database retrieval system