KEGG   Ferroglobus placidus: Ferp_2262Help
Entry
Ferp_2262         CDS       T01172                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
fpl  Ferroglobus placidus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Ferp_2262
Enzymes [BR:fpl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Ferp_2262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1949980..1950549
Genome map
AA seq 189 aa AA seqDB search
MIEEAIKIGKKLAAYGLIDGASGNLSFRKGGKIVITKTGVVLDELTEEDFVEVEIGKKED
EASSDLYVHERIYEETDYKAVLHCHGVYGVTLSLFFDEIIPLDLEGKMFIGNLKIVEGRF
GSPSLAEKIAKSVKEKGICLVRGHGIYAAGENFDEAFKLASYLEHSCQILFNYEVFRRVL
ANPYHACRQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagaagcaattaaaattggaaagaagctcgctgcttacgggttaatagacggt
gcgagcggaaatttgagctttagaaaaggtggaaaaatagtaataacgaaaaccggagtt
gttctggacgagttaacggaagaggacttcgttgaagtggaaatcggaaagaaggaggat
gaggcttcttcggatttgtacgtgcacgagagaatttacgaagaaaccgactataaagct
gttctccactgccacggagtttacggagttactctctccttattcttcgacgagataatc
cccttagatctggaaggaaaaatgtttattggcaatcttaaaatcgttgagggaagattt
ggctccccctccttagctgagaaaattgcgaaaagtgttaaagagaagggaatatgcttg
gttagaggacacggcatttatgcagctggcgagaattttgacgaagctttcaaacttgca
agctatttagagcattcctgccaaatcctcttcaactacgaggttttccgtagagttctt
gcaaatccttaccacgcttgtaggcagtga

DBGET integrated database retrieval system