KEGG   Ferroglobus placidus: Ferp_2363Help
Entry
Ferp_2363         CDS       T01172                                 

Definition
ATPase associated with various cellular activities AAA_5
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
fpl  Ferroglobus placidus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ferp_2363
Enzymes [BR:fpl01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Ferp_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2031671..2033092)
Genome map
AA seq 473 aa AA seqDB search
MEEYIFKEVEVKESSAPTFLLNGEEVDIFSDEFRAYWEKPLHELVREKILEYERRGEDPF
YEIVGKKIEKEMVKNALISGSSILFVGKKGYGKTTFSKSIAKLLPERQLAIKGCKIHDNP
VRPSCFACKRKVMEEEKVELTWIGRKWIRIPGDPMMTTRQLIGGISIQKIREGYDLDHPE
VFTPGRVLKANRGIAYFDELGSIPSALQTLLHELIEEKQVTTPEGEIVPLKIDAIFIAST
NPANYRGTEAIKEPLLDRMEAIPIGPPETLKEEIEIGLRNMSLKNGATIPEWHLKILARV
VRYARNKERCRYAARIESEPSCRATIKLFDHVKANATRKGRSVVMLSDYGECYEVIKLGL
RSRIEVDYEAEKDTIIEKLVEEAINRTCGEIYGSIEDSDFRKLSRELRKKEIINVYEDSP
KEMETFWKYILLMSRKPEEIPSAFEILLESIKRCTGLVERVGDGVYETRVQEL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtacatattcaaagaagtagaggttaaggaaagctcagcaccaaccttcttg
cttaacggagaagaggtagacatattttccgacgagttcagagcgtactgggaaaagccg
cttcacgagctcgtcagagaaaaaattctcgagtacgagaggagaggagaggatccgttc
tacgaaattgtcggaaagaagatcgaaaaagagatggttaagaatgccctgatttcaggc
tcaagcattcttttcgtcggtaagaagggttacggtaaaacaactttctcgaagtcgata
gccaagctccttccggagaggcagcttgctattaaagggtgcaagattcacgataatcca
gtaagaccgagctgctttgcttgcaagaggaaggtaatggaagaggaaaaagtggagcta
acttggataggaaggaagtggataagaattccgggagatccgatgatgacgacaagacag
ctcatcggtggtatcagcattcagaaaataagagagggatacgatttggatcatccggaa
gttttcacgccaggaagggtgcttaaagcgaacagaggtatcgcttatttcgacgaactc
ggttcgattccctcagctctgcaaacgctgcttcacgaacttattgaggaaaagcaggta
acgactccagaaggcgaaatagttccgctaaaaattgacgcgattttcatagcctcgact
aatccagccaactacagaggtaccgaagccataaaggagccgctccttgacagaatggaa
gccattccgataggacctccggaaacgttgaaagaggagatagagatcggtttgagaaac
atgagtctaaagaacggagcgacaattccagagtggcacctcaaaatcttggcgagagtc
gttagatacgcgagaaacaaagagagatgcagatatgcggcgagaatagaaagcgaacct
tcctgcagagctacaataaagctattcgaccacgtaaaggcgaacgctacgaggaaaggg
agaagcgtcgtgatgctttcggactacggagaatgctacgaggttatcaagctcgggttg
aggagtaggattgaagtggattacgaggctgaaaaggacacaataatagaaaagcttgtc
gaagaggcgataaacagaacttgcggtgaaatttacggcagcatcgaagattcagacttc
aggaagctttcgagggagcttaggaagaaagaaataataaacgtttacgaagactcgccg
aaagaaatggagaccttctggaagtacatactattaatgagcagaaagccggaagagatt
ccttcagctttcgagattctcctcgaatcgataaagagatgtacgggcttggtggagagg
gtcggagatggagtttacgaaaccagagtgcaggagctgtaa

DBGET integrated database retrieval system