KEGG   Ferroglobus placidus: Ferp_2387Help
Entry
Ferp_2387         CDS       T01172                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fpl  Ferroglobus placidus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Ferp_2387
   00052 Galactose metabolism
    Ferp_2387
   00500 Starch and sucrose metabolism
    Ferp_2387
   00520 Amino sugar and nucleotide sugar metabolism
    Ferp_2387
Enzymes [BR:fpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Ferp_2387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2054534..2055370
Genome map
AA seq 278 aa AA seqDB search
MKVRKAVIPAAGYGTRMLPITKAQPKEMVPVVHKPVIQYVVEEAYHSGIREILIITGKHK
RAIEDHFDRSDLTKKDKYTEELDRILEEVNIFFVRQREQKGLGDAVRYAEAFVDDEPFAL
LLGDNITIPPCTKMLIDAFEKYKFTVIALERVPLERVSFHGIVKGSEVEKGVYKLEDLIE
KPKIEEAPSNLAVIGRYILVPEIFDYLKDLKPGYGGEIQLTDALRHMCRDFDVYGILYDG
KRYDIGNKLEWLKANIELALKDEELGEEFKRWLIKLRI
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaggaaggctgtgattccagctgcaggatatggaaccaggatgcttccgatt
actaaagcccagcccaaggagatggtgccggtagtccacaagccagtgatccaatacgtt
gtcgaggaggcttatcattccggcataagagagattctgataataacgggtaagcataag
agggctatcgaggatcactttgatagaagcgatttaaccaagaaagataagtacacggaa
gagctcgatagaattttggaagaggtgaacatattcttcgtgaggcagagagagcagaag
gggttgggagatgctgtaaggtatgctgaggcttttgttgacgatgagccttttgctttg
ttgttgggagataacattacgattcctccctgcacgaagatgttgatcgatgctttcgag
aaatataaatttacggtaatcgccttggaaagagttcctttggaaagagtttcctttcac
gggatagttaagggttcagaagtcgaaaaaggtgtttacaaactcgaagatctaattgaa
aagccgaagattgaagaagcaccatcaaacctcgccgtaatcggaaggtatatacttgtt
ccagagatttttgattatttgaaggatttgaagcccggatacggtggagagattcagctc
acagacgctttaagacatatgtgcagagatttcgacgtttacggaattctgtatgatgga
aagagatacgacatcggaaacaagctggagtggttgaaggctaacattgagctggctttg
aaggatgaagagctgggggaagagtttaaaagatggttaattaagctgagaatatga

DBGET integrated database retrieval system