KEGG   Ferroglobus placidus: Ferp_2401Help
Entry
Ferp_2401         CDS       T01172                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase and related enzyme
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
fpl  Ferroglobus placidus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Ferp_2401
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ferp_2401
Enzymes [BR:fpl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Ferp_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2064008..2064508
Genome map
AA seq 166 aa AA seqDB search
MLPGIVVKPLKRFADERGFFTEIMRKDWSDIFKDEIVQANLSITYPGIVRAWHKHERGQV
DYFVCIKGAIKICVYDEKTQELAEIISTGDNPQVVRVPGHYWHGFKAIGVEPAMLVYFVS
RLYDYENPDEVRRPWNDPTVVPKIINGRTDDPRCNKPWDWFYPPYK
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgctccctggtatagttgttaaacctctaaagaggtttgcagatgagaggggatttttc
accgaaataatgcgtaaggactggagtgatattttcaaagatgagatagttcaggcgaat
ctgtcaattacctatccagggatcgttagagcctggcacaaacacgagaggggacaagtt
gattactttgtctgcattaaaggagcaatcaaaatttgtgtctacgatgaaaaaactcag
gagttagctgaaattatttccactggagataatcctcaagttgtcagagttcccgggcac
tactggcatgggtttaaagctatcggcgttgagccagcgatgttggtctatttcgtgagt
aggttgtatgattacgagaaccctgacgaagtgcggagaccttggaacgatcctacagta
gttccaaagataataaatggtagaactgacgatccccgctgtaacaagccgtgggactgg
ttctacccaccatataaataa

DBGET integrated database retrieval system