KEGG   Ferroglobus placidus: Ferp_2451Help
Entry
Ferp_2451         CDS       T01172                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
fpl  Ferroglobus placidus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ferp_2451
Enzymes [BR:fpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Ferp_2451
Peptidases [BR:fpl01002]
 Cysteine Peptidases
  Family C44
   Ferp_2451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2101333..2102490
Genome map
AA seq 385 aa AA seqDB search
MSIFVTSDIREGKIERIYANTRYPSVQEGLTFFDAAEKPKISEKAPVENRMLYYVVSFKP
SHVFISRDVLGSKPIYFSEDLTISSFKWYFEEEPMKVLPGEVLKISYDGEVIYRKTYSFF
DVFEKKAVDDPAEEIIKILEKVKIKDACISFSGGVDSGLLAGIYDAPLISVTASEKEEEW
LREAANMLGKEIEIFRFSAKDVRDNLRKIVGSIETTNTLQVSIAVPVYFVTKFAKELGYN
KVVFGQGADELFGGYKRYEHVVGKALEDALIEDIRRIGEENLERDSKIAYKNEVMPILPY
LSFDMIELALAIPASEKVKRVEGKVIRKYVLREAAKKVIPEEIAIRDKKAIQYSTGTYKI
LERLAREEKLPLDEYLKKIRYGSSS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatattcgtaacgtcggatatcagggagggtaagatagagagaatctacgcaaac
acgaggtatccttccgttcaggagggcttgactttttttgatgcggcagaaaaaccgaaa
atatcggaaaaagctccggtagagaacagaatgctctactatgtcgtttccttcaaaccg
tcccacgttttcatatcgagagacgttcttggctcgaagcctatatacttctccgaagat
ttgacgatatcctcgtttaaatggtacttcgaagaagagccgatgaaagtcttgccggga
gaagttttgaagatttcctatgacggagaggtaatttacaggaaaacctacagcttcttc
gacgttttcgagaagaaagcagtagatgaccccgctgaggagataataaaaatactcgaa
aaagtaaagataaaagacgcctgcatctccttctccggaggagtcgattcggggcttttg
gctggaatttacgacgccccactaatttccgttacagcttctgaaaaagaggaagagtgg
ttgagagaagctgccaacatgctcgggaaagagatcgagatcttcagattttcagccaag
gatgttagagacaacttgaggaaaatagtcggaagcatcgaaacaacaaatactctccag
gtttcgatagccgtgccggtttatttcgtaacaaagtttgccaaggagctcggctacaac
aaagtcgttttcggacaaggcgctgacgaactctttggtggatacaagaggtacgagcac
gttgtcggaaaagcgttggaagacgcgttaatagaagatataaggagaataggcgaggaa
aaccttgagagggactcgaagatagcttacaaaaacgaagttatgccgatccttccctac
ctttccttcgacatgatagagttagctttggcgattccggcaagtgaaaaagtaaagagg
gtggaggggaaagttataaggaagtacgtgttaagagaggcggctaaaaaagttattccc
gaggaaatagcgataagggataaaaaagcgatccagtactctaccggcacgtacaaaatc
ctcgaaaggcttgcgagagaggagaaacttcctcttgatgagtatcttaagaaaatcagg
tatggaagtagttcttga

DBGET integrated database retrieval system