KEGG   Ferroglobus placidus: Ferp_2477Help
Entry
Ferp_2477         CDS       T01172                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fpl  Ferroglobus placidus
Pathway
fpl00010  Glycolysis / Gluconeogenesis
fpl00052  Galactose metabolism
fpl00500  Starch and sucrose metabolism
fpl00520  Amino sugar and nucleotide sugar metabolism
fpl00521  Streptomycin biosynthesis
fpl01100  Metabolic pathways
fpl01110  Biosynthesis of secondary metabolites
fpl01120  Microbial metabolism in diverse environments
fpl01130  Biosynthesis of antibiotics
fpl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferp_2477
   00052 Galactose metabolism
    Ferp_2477
   00500 Starch and sucrose metabolism
    Ferp_2477
   00520 Amino sugar and nucleotide sugar metabolism
    Ferp_2477
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ferp_2477
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Ferp_2477
Enzymes [BR:fpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ferp_2477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Hydant_A_N BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ADC66585
UniProt: D3S294
Position
complement(2121443..2122186)
Genome map
AA seq 247 aa AA seqDB search
MLAGVDVGGTFTDVVVKEGEEFVHVKTLKTSEFLKDPEFVEKYSNAVFAIAGWIRGGKIL
RTPNIPEFNAKLFEGKRIENDANCFAIYAHHVTGFENLFAVTLGTGVGGAIIADSKLYKG
NGLASEIGHAFVGGDEKCVCGGVGHLETFFSGWTIKKKFGRELTREELIKFDGFKILCAE
VARAVMILDPEAVVFGGRIASILEPEDFEQIYNFLPSEFRPEIRIIKDPLAVAKGAAILA
GEKDGHG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcaggcgtggatgtcggaggaacttttacagatgttgttgtcaaagaaggagaa
gaattcgttcacgttaaaactctaaaaacgtcagaattcttgaaagatccagaattcgtt
gagaaatacagtaacgcggttttcgctattgcaggatggattagaggagggaaaattctg
aggacgccgaacattccagagtttaacgcgaagcttttcgagggaaagagaattgaaaac
gacgcaaactgctttgcgatctacgctcaccacgtaacaggattcgaaaacctttttgca
gttactctcggcaccggagtgggtggagcgataattgccgattcgaaactttacaaagga
aacggtttagcttctgaaatagggcatgcatttgtcggtggagacgaaaaatgcgtttgc
ggtggtgtagggcatcttgaaaccttttttagcgggtggacaattaaaaaaaagtttggg
agagaattaacgagagaagaattaataaaattcgatggattcaaaattttatgcgctgaa
gttgcaagagccgtcatgattctcgatccggaagctgtcgtgttcggaggaaggatagcg
tcgatactcgagcctgaagatttcgagcagatatacaactttttgccttcggaattcaga
ccggagataagaattataaaagatccgctcgcagttgcgaagggagcggcaattttggcg
ggtgagaaagatggacatggttga

DBGET integrated database retrieval system