KEGG   Ferroglobus placidus: Ferp_2477Help
Entry
Ferp_2477         CDS       T01172                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fpl  Ferroglobus placidus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ferp_2477
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ferp_2477
   00052 Galactose metabolism
    Ferp_2477
   00500 Starch and sucrose metabolism
    Ferp_2477
   00520 Amino sugar and nucleotide sugar metabolism
    Ferp_2477
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ferp_2477
   00524 Butirosin and neomycin biosynthesis
    Ferp_2477
Enzymes [BR:fpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Ferp_2477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2121443..2122186)
Genome map
AA seq 247 aa AA seqDB search
MLAGVDVGGTFTDVVVKEGEEFVHVKTLKTSEFLKDPEFVEKYSNAVFAIAGWIRGGKIL
RTPNIPEFNAKLFEGKRIENDANCFAIYAHHVTGFENLFAVTLGTGVGGAIIADSKLYKG
NGLASEIGHAFVGGDEKCVCGGVGHLETFFSGWTIKKKFGRELTREELIKFDGFKILCAE
VARAVMILDPEAVVFGGRIASILEPEDFEQIYNFLPSEFRPEIRIIKDPLAVAKGAAILA
GEKDGHG
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcaggcgtggatgtcggaggaacttttacagatgttgttgtcaaagaaggagaa
gaattcgttcacgttaaaactctaaaaacgtcagaattcttgaaagatccagaattcgtt
gagaaatacagtaacgcggttttcgctattgcaggatggattagaggagggaaaattctg
aggacgccgaacattccagagtttaacgcgaagcttttcgagggaaagagaattgaaaac
gacgcaaactgctttgcgatctacgctcaccacgtaacaggattcgaaaacctttttgca
gttactctcggcaccggagtgggtggagcgataattgccgattcgaaactttacaaagga
aacggtttagcttctgaaatagggcatgcatttgtcggtggagacgaaaaatgcgtttgc
ggtggtgtagggcatcttgaaaccttttttagcgggtggacaattaaaaaaaagtttggg
agagaattaacgagagaagaattaataaaattcgatggattcaaaattttatgcgctgaa
gttgcaagagccgtcatgattctcgatccggaagctgtcgtgttcggaggaaggatagcg
tcgatactcgagcctgaagatttcgagcagatatacaactttttgccttcggaattcaga
ccggagataagaattataaaagatccgctcgcagttgcgaagggagcggcaattttggcg
ggtgagaaagatggacatggttga

DBGET integrated database retrieval system