KEGG   Faecalibacterium prausnitzii L2-6: FP2_11340Help
Entry
FP2_11340         CDS       T02591                                 

Definition
Pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
fpr  Faecalibacterium prausnitzii L2-6
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:fpr00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fpr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1116378..1117328)
Genome map
AA seq 316 aa AA seqDB search
MLTVTVAQDGSGDFASIAEAVLAVPYEEEALVQIGPGIYREKLVCEKRCITLRGAGADKT
KLVWGDGGRLPHKDGRPTHTFRSYTAFFSGETLCVEEMTIENDAGPGAKAGQAVAAYVDS
TRAVFRRVKLLGSQDTLFCAPLPEKEREKDGFLGPRGLAPRKPTAQYYTDCEIAGDIDFI
FGGGDALFENCVIRTVDNHIPHSYVTAPSGRADGLGFVFWNCDFVSDCPAGSVYLGRPWR
PEGKTAVLGCRLGAHIAPEGFIAWNDRTDTGLASFAEADSTGPGAAERPAWVKQLSGPEA
AELLARARTLCRPKTN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgctgacagttacagttgcacaggacggcagcggcgacttcgcgtccatcgcggaggcg
gtgctggccgtaccctatgaggaggaagcactggtgcagatcggccccggcatttaccgg
gaaaagctggtctgcgaaaagcgctgcatcaccctgcggggggcgggtgcagataagaca
aaactcgtgtggggcgacggcggcaggctgccccacaaggacgggcggcccacccatacc
ttccgcagctacaccgcctttttcagcggcgaaacgctctgcgtggaggagatgacgatc
gaaaacgacgccggcccgggcgcgaaagccgggcaggccgtcgcggcctatgtggacagc
acccgggcggtgttccgccgggtcaagctgctgggcagtcaggacacgctcttctgcgcc
ccgctgcccgaaaaggagcgggagaaggacggctttctcggcccgcgcggtcttgcgccc
cgcaaaccgaccgcccaatactacaccgactgtgagatcgcgggcgacattgatttcatc
tttggcggcggcgacgccctcttcgaaaactgcgtcatccgcacggtggacaaccacatc
cctcacagctatgtcacagctccttcgggcagggcagacggactgggctttgtgttctgg
aactgcgatttcgtctccgactgcccggcaggcagcgtctatctggggcgtccgtggcgt
cccgagggcaagacggcggtgctgggctgccgcctcggcgcccacatcgcgccggaaggc
tttatcgcatggaatgaccgcaccgataccggccttgccagctttgcggaagctgacagc
accggcccgggcgcagcagagcgcccggcgtgggtgaaacagctttccgggccggaggcg
gcggaactgctggcccgcgcccgcaccctctgccgaccgaaaaccaactga

DBGET integrated database retrieval system