KEGG   Faecalibacterium prausnitzii L2-6: FP2_13480Help
Entry
FP2_13480         CDS       T02591                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fpr  Faecalibacterium prausnitzii L2-6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FP2_13480
Enzymes [BR:fpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     FP2_13480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1325604..1327181)
Genome map
AA seq 525 aa AA seqDB search
MRESGILMPVSSLPGPYGIGCFGAEALKFVDFLAAAGQHIWQLLPLSPTGYGDSPYQSCS
AFAGNPYFIDLDALKADGLLTAAQLKAEKWGDDPLSVDYGTLYTSRYKVLRTAYAAWREK
YAGLHGCAHYYPDDYYAFALANDSWLNDYALYMALKTANGMKSWTEWPREYRLRDAAALA
KFAAGQEEEIGFWKFLQYEFATQWKKVKDYANDKGVKILGDIPIYVSADSVDAWVGGELF
ELDAQGSFARVAGCPPDYFSADGQLWGNPLYNWPYHKQTGYAWWIRRVRHALGIYDLLRI
DHFRGFDTYWAIPAGSPTACTGKWEIGPRMDLFHALEAALGKLPIIAEDLGELFPSVREL
LADSTFPGMKVLQFAFGGGDNEYLPHNHVKNSVVYPGTHDNTTLTDWWENAATGKEKANV
AAYLHLTPCKPTAKEVAAVKPDAARIALLRAALGSVADRAIIPMSDWLGLGAEAHLNTPG
KLGGNWTWRAAEGFDAEPLASRIQAECDVYCRAKEPVEKEAKTSI
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaagtggaatcctgatgccggtgtccagcctgcccggcccctatggtattggc
tgctttggcgccgaagcgctcaagttcgtggattttctggccgctgcgggccagcacatc
tggcagctgctgcccctcagccccaccggctacggcgacagcccctaccagagctgctct
gcctttgcgggcaacccctacttcatcgacctcgacgccctcaaggccgacggcctgctg
accgccgcccagctcaaggcggaaaagtggggtgatgacccgctttcggtggactacggc
actctctacaccagccgctataaagtgctgcgcaccgcctacgccgcatggcgcgagaag
tacgccggtctccacggctgcgcccactactaccccgacgactactacgccttcgccctt
gccaacgacagctggctgaatgattacgccctctacatggccctcaagaccgccaacggc
atgaagagctggactgagtggccccgggagtaccgcctgcgggacgccgccgcgctggca
aagttcgcagcagggcaggaagaggagatcggcttctggaagttcctgcagtacgagttt
gccacccagtggaagaaggtcaaggactacgccaacgacaagggcgtgaaaattctgggt
gacatcccgatctacgtctctgccgactcggtggatgcatgggtgggcggcgagctcttc
gagctggacgcgcagggaagctttgcccgcgtggccggctgtccgccggattatttctcc
gcagacggccagctctggggcaacccgctgtataactggccgtatcataaacagacggga
tacgcctggtggatccggcgcgtccgccacgccctcggcatctacgacctgctccgcatc
gaccacttccgtggcttcgacacctactgggccatcccggcgggcagccctaccgcctgc
accggcaagtgggagatcggcccccggatggacttgttccacgcactggaagctgccctt
ggcaagctgcccatcatcgcggaagatctgggcgagctgttccccagcgtccgcgagctg
ctggccgacagcaccttcccgggcatgaaagttttgcagttcgctttcggcggcggcgac
aacgagtatctgccccacaaccacgtcaagaacagcgtggtctacccgggtacccacgac
aacaccaccctcaccgactggtgggagaacgccgccaccgggaaggaaaaggccaatgtc
gccgcttacctccacctgaccccctgcaagcccaccgcgaaggaagtggctgccgtcaag
ccggacgccgcccgcatcgcgctgctgcgtgcggccctcggctctgtggctgaccgggcc
atcatccccatgtccgactggctgggtctgggcgcagaagcccatctgaacacccccggc
aagctgggcggcaactggacttggcgcgccgcggagggcttcgacgcagagcctctggcc
agccgtatccaggctgagtgcgatgtctactgccgcgccaaggagccggtcgaaaaagag
gccaaaacctcaatttga

DBGET integrated database retrieval system