KEGG   Faecalibacterium prausnitzii L2-6: FP2_14400Help
Entry
FP2_14400         CDS       T02591                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fpr  Faecalibacterium prausnitzii L2-6
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fpr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FP2_14400
Enzymes [BR:fpr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     FP2_14400
Exosome [BR:fpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FP2_14400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1422676..1424841
Genome map
AA seq 721 aa AA seqDB search
MKPTEEKTRSNPSDLPVYLFKQGNNCEAYRYFGAHIEQRAGETGVVFRVWAPHATAISVV
GDFNSWKPGSHPMRKVDNDSVWELFIPGMKEYDVYKYCVTTRAGDLVYKADPYAFHAETR
PSNGSKVYDLNGFVWHDEAWQNAQKKADVINGPMNIYEMHAGSWKQKEGGLPYNYSELAD
ELIPYITEMGYTHVELLPVMEYPFDGSWGYQVTGYFAPTSRYGTPKDLMAFVDKMHEAGI
GVIMDWVPAHFPKDQFGLYNFDGEACYEDPNPKRGEHKEWGTMVFDFGRSEVQSFLISSA
LYWLEQYHIDGLRVDAVASMLYLDYNRKQGEWEPNKDGGKENLEAVAFLRKLNDTVLGRH
PHKYMIAEESTAWPMVTKPASDGGLGFNFKWNMGWMNDMLSYMKTDPLFRSGNHNKVTFS
FFYAFSENFVLPISHDEVVHGKGSLINKMPGDYEAKFANLRTFFGYMMAHPGKKLLFMGQ
EFGQFTEWNETKSLDWMLLGYDKHTELQTYVKTLNKFYKDHPAFWQIDYSWEGFQWIVPD
DSRQSVVAFLRKDANGKQILVVCNFNPVLREGYTLGAPNSGTYKEILNSDDEAFGGAGTV
HNKAVRSKKKPLHGFEQSITITLPPMSVLYFEVPAKRTRKTAEEKAAEKAAPKKASRTAK
AEKAEEKAPAKRGRKPKAEAAPAEEKAPAKRGRKPKAEKAAKPAEKPARKPCARKADKAE
K
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgactgaggaaaagacccgcagcaatccatcggaccttccggtgtatttgttc
aagcagggcaataactgtgaagcgtaccgctattttggcgcacacatcgagcagcgggcc
ggggagacgggcgtggtgttccgcgtctgggcaccacacgcgacggccatcagcgtagta
ggcgatttcaatagctggaaaccgggcagccacccgatgcgcaaggtggacaatgactct
gtgtgggagctgttcatcccgggcatgaaggaatacgacgtttacaaatattgcgtgacc
acccgggcgggcgaccttgtctacaaggctgacccctatgcgttccacgcagagacccgc
ccctcgaacggcagcaaggtctacgatttgaacggctttgtctggcacgacgaggcgtgg
cagaacgcccagaagaaggccgatgtcatcaacggccccatgaacatctacgagatgcac
gccggcagctggaagcagaaagagggcggcctgccctacaattactccgagctggccgac
gagctcatcccgtacatcaccgagatgggctacacccatgtggagctgctgcccgtcatg
gagtaccccttcgatggcagctggggctatcaggtgacgggctatttcgcccccaccagc
cgctacggcaccccgaaggacctgatggctttcgtggacaagatgcatgaggcgggcatc
ggcgtcatcatggactgggtgccggctcacttcccgaaagaccagttcggcctgtacaac
ttcgatggcgaagcctgctacgaggacccgaaccccaagcgcggcgagcacaaagagtgg
ggcaccatggtgttcgactttggccgcagcgaggtgcagagcttcctcatctccagcgcg
ctctactggctggagcagtaccacatcgacggcctgcgggtggacgctgtggcttccatg
ctctatctggactacaaccgcaagcagggcgagtgggagcccaacaaggacggcggcaag
gagaaccttgaggctgtggcattcctgcgcaagctcaacgatacggttctgggccgtcac
ccccacaagtacatgatcgcagaggagtccaccgcctggccgatggtcacgaaacccgct
tccgacggcggcctgggcttcaatttcaagtggaacatgggctggatgaacgatatgctc
agctacatgaagaccgacccgctcttccgttcgggcaaccacaacaaggtcacattcagc
ttcttctacgccttcagcgagaacttcgtgctgcccatcagccacgacgaagtcgtccac
ggcaagggcagcctcatcaacaagatgcccggtgactatgaggccaagtttgcaaacctg
cgcaccttctttggctacatgatggctcaccccggcaagaagctgctgttcatgggtcag
gagttcggccagttcaccgagtggaacgagaccaagtctctggactggatgctgctgggt
tacgacaagcacaccgagctgcagacctacgtcaagaccctgaacaagttctacaaggac
catcccgccttctggcagatcgactacagctgggagggcttccagtggatcgtccccgac
gactcccgtcagagcgtcgtggccttcctgcgcaaggatgcaaacggcaagcagatcctc
gtggtctgcaacttcaaccccgtcctgcgcgagggctacaccctgggcgcaccgaactcc
ggcacctacaaggagatcctgaacagcgacgacgaggcgttcggcggtgccggcactgtc
cacaacaaggctgtccgctccaagaagaagccgctccacggcttcgagcagagcatcacc
atcactctgcctcccatgagcgtgctttatttcgaggtgcccgcaaagcgcacccgcaag
accgccgaggagaaggccgcggaaaaggctgcgcccaagaaggcttccaggaccgcaaag
gccgaaaaggctgaggaaaaggcccccgcaaagcgcggccgcaaacccaaggcagaagct
gcacctgcggaagaaaaggctccggcaaaacggggccgtaagcccaaggcagaaaaggcg
gcgaaaccggctgaaaagcccgcccgcaagccctgtgccaggaaggcggacaaggccgaa
aaataa

DBGET integrated database retrieval system