KEGG   Faecalibacterium prausnitzii L2-6: FP2_24240Help
Entry
FP2_24240         CDS       T02591                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
fpr  Faecalibacterium prausnitzii L2-6
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    FP2_24240
Enzymes [BR:fpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FP2_24240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2435628..2436230)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFRYGAMNSGKSTALMQVAHNYEEQGMRVLILKPKVDTKGSGDLVSRLGVRRPADL
LVPPDMDLVEAVRAASSEGRPLACVLCDESQFLTAEQAEQLFMVTVELNIPVICYGLRSD
FSLKGFPGSTRLLELAHTIEEMKTICTCGRKATCNCRKVNGRFVFEGEQVAIDLENDVQY
VSMCPQCYFRERSAFYAARR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctttatttccgttacggcgcaatgaacagcggcaagagcaccgcgctgatg
caggtggcccacaactacgaggagcaggggatgcgggtgctcatcctcaagccgaaggtg
gacaccaagggcagcggcgacctcgtgagccgtctgggcgtccgccgccctgccgacctg
ctggtgccgccggacatggacctggtggaggccgtccgggccgccagcagcgagggccgg
cctctggcctgtgtgctctgtgacgagagccagttcctcactgccgagcaggccgagcag
ctgtttatggtgacggtagagctgaacatccccgtcatctgctacggcctgcgctccgac
ttctccctcaagggcttccccggctccacccggcttctggagctggcccacaccatcgag
gagatgaagaccatctgcacctgcggccgcaaggccacctgcaactgccgcaaggtcaac
ggccgcttcgtctttgagggcgaacaggtagccatcgaccttgagaacgacgtccagtac
gtcagcatgtgtccccagtgctatttccgggagcgcagcgccttctacgccgcccgccgg
tga

DBGET integrated database retrieval system