KEGG   Flavobacterium psychrophilum JIP02/86: FP0035Help
Entry
FP0035            CDS       T00548                                 

Gene name
hemB
Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FP0035 (hemB)
Enzymes [BR:fps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     FP0035 (hemB)
Exosome [BR:fps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FP0035 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(68582..69574)
Genome map
AA seq 330 aa AA seqDB search
MFPLQRGRRLRINQSIRSLVRETTLSPSDFMFPMFITEGENIKVEIPSMVGIYRHSIDLT
VEEVKEIFALGIRAVNIYVKVNESLKDNTGKESWNPDGLMQRAIKAIKTACPEMIVMPDV
ALDPYSIYGHDGIIQNGDIANDATNTALVKMAVSHAQAGADFVAPSDMMDGRVLRLRQGL
DSAGFHNVGIMSYAAKYASAFYGPFRDALDSAPVNNAEIPKDKKTYQMDYANRIEAIKEA
LMDVEEGADMVMVKPGIAYLDIVREVKNAVNIPVTVFHVSGEYAMIKAAAERGWLDHDKI
MMEQLMCIKRAGASLISTYFAKEAAILLNK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgttcccacttcaaagaggcagacgcttaagaattaaccaatctattagaagtttagtt
cgtgaaacaaccctaagccctagcgattttatgttcccaatgtttattacagaaggagaa
aacataaaagtagaaatcccatcgatggttggaatttaccgccattctatcgatttaact
gtcgaggaagtcaaagaaatattcgctttgggaattagagctgtaaacatttatgtaaaa
gtaaatgaatctctaaaagacaataccggaaaagaatcctggaatcccgatggattaatg
caacgcgctatcaaagccattaaaaccgcatgcccagaaatgatcgtcatgccagatgtg
gcactagacccttattctatttacggtcacgacggaattattcaaaatggcgatattgca
aatgatgcaacaaataccgcattagtaaaaatggctgtttcacacgcacaagcaggagca
gatttcgttgccccttccgatatgatggacggccgtgtacttcgtttgcgccaaggtcta
gactccgcaggttttcataacgtaggaattatgagttatgctgctaaatatgcttcagct
ttttacggaccatttcgcgacgcattagacagtgcacctgtaaacaatgccgaaattccg
aaagacaaaaaaacctatcagatggattatgccaacagaattgaagccatcaaagaagca
ttaatggatgtagaagaaggagctgacatggtcatggtaaaacccggaattgcctattta
gacattgtacgagaagttaaaaacgctgtaaatattcccgtaaccgtttttcatgtttct
ggcgaatacgcaatgataaaagccgctgccgaaagaggatggttagatcacgacaaaatc
atgatggaacaattaatgtgtataaaaagagctggagctagtttaatatcaacatatttt
gccaaagaagccgcaattctgttaaataaataa

DBGET integrated database retrieval system