KEGG   Flavobacterium psychrophilum: FP0182Help
Entry
FP0182            CDS       T00548                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fps  Flavobacterium psychrophilum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FP0182
Enzymes [BR:fps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FP0182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
234719..235468
Genome map
AA seq 249 aa AA seqDB search
MKVKTILVSQPEPKVENSPYFELQNKHKVKIDFRPFIHVEGVLAKDVRTQKIDLNNFTAI
ILTSKNSVDHFFRVAEEMRYKVPEDLKYFCQSEAVAFYLQKYVVYRKRKIYVGQKDFVDM
STLFKKYKDEKYLLPSSDQLNADITQTLNNLKVDWIAGTFYKTVMSDLSDLKDVYYDVLA
FFSPTGIKSLFKNFPNFEQKDTRIAVFGSTTQKEALEHGLRIDILAPTPETPSMTMALEK
YVAEANKGK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaaaacaattttagtttcacaacctgaaccaaaggttgaaaactctccttat
tttgagttacaaaataagcacaaggttaaaattgatttcagaccgtttattcatgtggaa
ggcgtcttggcaaaagatgttcgtacacaaaagatagatttgaacaattttacggctatt
attctaaccagtaaaaactcggtagaccatttttttagagtggcagaagaaatgcgttat
aaagtacctgaggatttgaaatatttttgccaatctgaagcggtggcattttatcttcaa
aaatacgttgtgtacagaaaacgtaaaatatacgtgggacaaaaagattttgtagatatg
tctactttatttaaaaaatacaaagacgaaaaatatcttttgccctcctcagaccagctt
aatgcagatattacccagactctaaacaacttaaaagtcgattggattgcgggaacattt
tataaaacagtcatgagtgacttgtctgatctaaaagatgtttactacgatgtgttagcc
ttttttagtccaacaggaataaaatcattgtttaaaaacttcccaaatttcgaacaaaaa
gacactagaattgctgtttttggaagcacaactcaaaaagaagcattagaacatggttta
cgaatagatattttggcaccaacaccagaaacaccatctatgactatggctttagaaaaa
tatgttgcagaagcaaacaaaggaaaataa

DBGET integrated database retrieval system