KEGG   Flavobacterium psychrophilum JIP02/86: FP0328Help
Entry
FP0328            CDS       T00548                                 

Gene name
dfrA
Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FP0328 (dfrA)
   00670 One carbon pool by folate
    FP0328 (dfrA)
Enzymes [BR:fps01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     FP0328 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2262628..2263116
Genome map
AA seq 162 aa AA seqDB search
MITIIAAAGKNNELGKDNQIIWHLPDDFKRFKAITSGHHIIMGRKTFESFPKPLPNRTHI
VITRNKNYSLPEDCFVVDSIEKAIDICPKNKTIFIIGGGEIYKQSINIANCIELTRVHGD
FDADAFFPTIDLTKWELVSSQFHEKDEKHQFSFTFETYTKII
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgattacaattattgcagcagctggcaagaacaacgaattgggaaaagacaatcagatt
atttggcatttacccgatgattttaaaagatttaaagccataacctcaggccatcatatt
attatgggaagaaaaacttttgaaagtttccctaaaccattacccaaccgaacccacatt
gttattactcgaaacaagaattacagtcttcctgaggattgctttgtagtagattcaatc
gaaaaggctattgatatttgtccgaaaaacaaaactatttttattattggcggtggcgaa
atttacaaacaatctataaatatcgccaattgcatagaactcactcgtgtgcatggcgat
tttgatgctgatgcgtttttcccaacaatagatttaacaaaatgggaattagtctcttct
cagtttcatgaaaaagacgaaaaacatcaattttcgtttactttcgaaacttatactaaa
ataatttaa

DBGET integrated database retrieval system