KEGG   Flavobacterium psychrophilum JIP02/86: FP0508Help
Entry
FP0508            CDS       T00548                                 

Gene name
trpB
Definition
(RefSeq) Tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00260  Glycine, serine and threonine metabolism
fps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fps01100  Metabolic pathways
fps01110  Biosynthesis of secondary metabolites
fps01130  Biosynthesis of antibiotics
fps01230  Biosynthesis of amino acids
Module
fps_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FP0508 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FP0508 (trpB)
Enzymes [BR:fps01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FP0508 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 5299913
NCBI-ProteinID: YP_001295432
UniProt: A6GWZ1
Position
complement(689143..690324)
Genome map
AA seq 393 aa AA seqDB search
MSFHVNQKGFYGNFGGAYIPEMLYPNVEELRQNYIKITAEPEFQKEFHELLKDYVGRPTP
LYFAERLSKEYNTKIYLKREDLCHTGAHKVNNTIGQILLAKRLGKTRIIAETGAGQHGVA
TATVCALMGLQCIVYMGEIDIKRQAPNVARMKMLGAEVRPATSGSKTLKDATNEAIRDWI
NNPTNTYYIIGSVVGPHPYPDMVARFQSVISQEIKTQLLEKEGQENPDYIIACVGGGSNA
AGAFYHFLDEKEVNIIAVEAAGKGIDSGESAATSALGKIGIIHGSKTLLMQSPDGQITEP
YSISAGLDYPGVGPMHAHLFETKRAQFISITDDQAMNWGIKMSQTEGIIPAIESAHAFAV
LDHKKFKPTDIVVINLSGRGDKDLNTYIDYFKL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagttttcacgttaaccaaaaaggattttacggcaattttggaggagcctatattccc
gagatgctatacccaaatgtcgaagaattaagacaaaactatatcaaaataacagcagaa
cctgaatttcaaaaagaatttcatgagctactaaaagattatgtaggccgccctactcca
ctttattttgccgagagattatcaaaagaatacaatacaaaaatttatctaaaaagagaa
gatttatgccatacaggcgcacacaaagtaaacaataccattggacaaattttactagca
aaacgccttggtaaaacccgtattattgcagaaactggcgcaggacaacacggagtagcc
acagcaaccgtttgcgcactcatgggtttgcaatgtattgtttacatgggtgaaatagac
attaaaagacaagcaccaaacgtagcgagaatgaaaatgctcggtgccgaagttcgtccc
gcaacatcaggttcgaaaaccctaaaagacgctacaaacgaagccattcgagattggata
aacaacccaacaaacacctattacattataggatccgtagttggtccgcatccttatcca
gatatggtagcacgttttcaaagtgtcatttcccaagaaataaagacacaattattagaa
aaagaaggacaagaaaatccagattatatcatcgcttgtgtaggtggcggaagcaatgcc
gcaggagctttttatcacttcctagacgaaaaagaagtaaacataattgcggtcgaagct
gccggaaaaggcatagattctggagaaagcgcagccacctcagcattaggcaaaatagga
attattcacggaagcaaaaccctgctcatgcaaagtccagacggacaaatcacagaaccc
tactctatctccgcaggattagattatcccggagttggccccatgcacgctcacttattc
gaaacaaaaagagcccaatttatctccatcactgatgatcaagccatgaattggggcata
aaaatgtctcaaaccgaaggcattattccagccatagaaagcgcacatgcttttgccgtt
ttagaccataaaaaatttaaaccaacagatattgtagtcatcaatctatcaggtcgtggc
gacaaagatttaaacacttatatcgattatttcaaattataa

DBGET integrated database retrieval system