KEGG   Flavobacterium psychrophilum: FP0568Help
Entry
FP0568            CDS       T00548                                 

Definition
Probable cytochrome c peroxidase precursor (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fps  Flavobacterium psychrophilum
Brite
Enzymes [BR:fps01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     FP0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
756311..758116
Genome map
AA seq 601 aa AA seqDB search
MKKCFLLIIIFSVFSCKNQPKHEKINEIFKTDIGLLIQRVAILENAIQSDASLAQIQTHF
LEAHQAYKQVEMISEYYFPVVSKAINGPALSEFEEDEGKTVPPEGFQVIEEFIFPKYDKK
SKKDLLKEIGILSANLKRLDTVSQTNELTDSHIFDAMRLEIFRTITLGITGFDSPIVQNS
IPEALSSIKSIEKYYKVYTKDSDDATFKTVLKTIEEAKSYLKTHHNFNAFDRGFFITKIA
NPLSIAICKTQNALKIPVIKEMRGLRTTAQTLFEENAFDAEAFSAFPDYQTTPEKIELGK
LLFNDPILSSNNTRSCASCHHSESAFTDGLEKATSFDGKSVVKRNTPTLSNIAFQRVFFS
DSRVNYLEDQALAVIANKNEMHGSLAESILRLKKEANYKTRFIQAFPKKEIDEFAVKNAL
ASYIRSLSNYDSKFDEYMRGNETLTNDEKEGFNLFAGKAKCATCHFIPLTNGTVPPHFEK
SESEVLGVPNNYKKIDEDLGKFELTKAEIHKYSFKTPTLRNIALTAPYMHNGVYKTLGEV
INFYNDGGGKGLGFNLSNQTLPEDKLNLTAIEKKQLIAFIKTLTDKNKINIKNQYQKSMK
I
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtgttttcttcttataataatattttcggttttctcttgtaagaaccaaccc
aagcatgaaaaaataaacgaaatatttaaaacagatattggtttgttaatacaaagagtt
gcgatactagaaaatgcgatacaatctgatgcgtctttagcacaaattcaaacacatttt
ttagaagcacatcaagcctacaagcaagttgaaatgattagcgaatattattttcctgtt
gtttctaaagctattaacggtcctgcattaagcgaattcgaagaagatgaaggtaaaact
gttcctccagaaggatttcaagttattgaagaatttatttttccaaagtatgataaaaaa
tctaaaaaagaccttttgaaagaaataggcattctatcagccaatttaaaaagattggat
accgtttctcaaaccaatgaattaacagattctcatatttttgatgcgatgcgtttagaa
atttttagaaccatcactttaggaattactggatttgattcgccaattgtacaaaattct
attccagaagctttatcttcaataaaaagtatcgaaaaatattacaaagtttatactaaa
gattcagatgatgctacatttaaaactgttttaaaaacaatagaagaggctaaatcctat
ctaaaaacacaccataattttaatgcttttgacagaggattttttataacaaaaatagca
aacccattaagcattgctatatgcaaaacgcaaaatgccttaaaaattcctgttattaaa
gaaatgagaggattaagaacaactgctcaaactttatttgaagaaaatgcttttgatgct
gaagctttttcagcatttccagattatcaaaccacgcccgaaaaaatcgaattaggaaaa
ttattatttaatgatcccattttatctagtaataatactcgttcatgtgcttcttgtcac
cactcagaatctgcatttactgatggtttagaaaaagcaacttcatttgacggaaaatct
gtagtaaaaagaaacacaccaacgctttctaatattgcattccaaagagtatttttttcg
gattctagggtaaattatcttgaagatcaggccttggcagtgattgctaataagaatgaa
atgcatggttctttggcagaatctattttgagattaaaaaaagaggcaaattataaaacc
cgattcatacaagcatttcctaaaaaggaaatagatgagtttgcggtaaaaaatgcttta
gcatcttatatcaggtcgttgagtaattatgattcgaaatttgatgaatatatgagagga
aacgaaacccttactaacgacgaaaaagaaggttttaatttatttgctggaaaagcaaaa
tgtgctacttgtcactttatcccattaacaaatggtacggttccgcctcattttgaaaaa
tcagaaagtgaagtgcttggcgttcctaataactacaaaaaaatagatgaagatttagga
aaattcgaattaacaaaagccgaaattcataaatattctttcaaaacaccaaccctcagg
aatattgccctaactgcaccatatatgcataatggggtttataaaacacttggcgaagtg
attaatttttataatgacggaggcggaaaaggattgggttttaacctttcaaaccaaacc
cttccagaagacaaattaaatttgacagctattgaaaaaaagcaacttatagcctttatt
aaaacattgactgacaaaaataaaatcaatatcaaaaatcaatatcaaaaatcgatgaaa
atctaa

DBGET integrated database retrieval system