KEGG   Flavobacterium psychrophilum JIP02/86: FP0579Help
Entry
FP0579            CDS       T00548                                 

Definition
Probable cytochrome c peroxidase precursor (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Brite
Enzymes [BR:fps01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     FP0579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
767267..768310
Genome map
AA seq 347 aa AA seqDB search
MKTKYILLLIMPFFWSCSKVDNTDNYVNIPIDYKVPSNFPPLAYDLNNNPLTEKGFELGK
KIFYDGRLSSDGLISCGFCHIQENAFTHHGHSVSHGVNNEVGIRNAPPIQNLAFQTSFMW
DGAASHLDMQSILPFTNPVEMNGNFGNTIAMMKSDAEYQKLFKIAFINREINSENMLKAL
GQFMVMVTSSNSRFDKYRRHETGGTLTQEELGGYTIFNQKCASCHATDLFTDNSFRNNGL
AINPQVNDIGRFRVTELAQDLHKFKVPSLRNIEKTAPYMHDGRFFTLDAVLDHYSNGIVN
SATLDPSLHTNGVLGISLTSLEKTKLIAFLKTLTDNQYLTDKRFSEY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaatatatattgttactcattatgccttttttttggagttgttctaaagtt
gataatacagataattatgttaatattccaatagactataaagtaccttcaaattttccg
ccattagcttatgatttaaataacaatccattaaccgagaaaggtttcgaattaggaaaa
aaaatattttatgacggaagattatcatcagatggattaatttcttgcggattttgtcat
attcaagaaaatgcttttacgcatcacgggcattctgttagccatggtgtaaataatgaa
gttggaataagaaatgcaccacctattcagaatttagcatttcaaactagttttatgtgg
gacggagcagcaagccatttagacatgcagtctattttaccttttacgaatccggtagaa
atgaatggaaattttggcaatacaattgccatgatgaaatctgatgctgaatatcaaaaa
ttattcaaaatcgcatttattaacagagaaataaactccgaaaatatgctaaaagcatta
ggacagtttatggttatggtaacatcaagtaactcccgttttgataaataccgaagacat
gaaacaggcggaacacttacacaagaagagttaggcggttatactatttttaatcaaaaa
tgtgcctcatgtcatgcaacagatttgtttacagacaattcctttagaaataacggtttg
gcgattaacccacaagttaatgatataggcagatttcgtgtcacagaattagcacaagat
ttgcataaatttaaagttccaagtcttagaaatatagagaaaacagcaccatatatgcat
gatggacggttttttacactcgatgctgttctagatcattactctaatgggattgtaaat
tctgcaacattagatccaagtttgcatacaaatggagtcttaggaatttcattaacgagt
ttagaaaaaacaaaattgatagctttcttaaaaaccttaaccgacaatcaatatcttacc
gataaacgattttcagaatattaa

DBGET integrated database retrieval system