KEGG   Flavobacterium psychrophilum: FP0590Help
Entry
FP0590            CDS       T00548                                 

Gene name
bfmBB
Definition
Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fps  Flavobacterium psychrophilum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FP0590 (bfmBB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FP0590 (bfmBB)
  Amino acid metabolism
   00310 Lysine degradation
    FP0590 (bfmBB)
Enzymes [BR:fps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FP0590 (bfmBB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
780221..781522
Genome map
AA seq 433 aa AA seqDB search
MARFELKLPKMGESVAEATITNWLKQVGDKIEMDEAVLEIATDKVDSEVPSEVSGILVEQ
LFNKDDLVQVGQTIAIIETEGGDVAVAKQEATPVAVAEVAKTVEAAKEAVSVPVNFSDSD
KFFSPLVKNIAKAEGVSVAELESISGSGKEGRVTKEDLLKYVADRKIEPRTKNQELAVVQ
ATKQQPVSQKAVPVSVNGGDEIIEMDRMRKLISGYMVASVQTSAHVQSFIEVDVTNIVKW
RNKVKDAFEKREGEKLTFTPIMMEAVAKALKDFPGMNISVDGDYIIKKKNINLGMAAALP
NGNLIVPVIKNADQLNLVGMAKAVNDLGNRAKAGKLKPDDTQGGTYTVTNVGTFGSVFGT
PIINQPQVGILALGAIRKVPAVIETPEGDFIGIRQKMFLSHSYDHRVVDGALGGSFVKRV
ADYLEAFDVNRDF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatttgaattaaaacttccaaaaatgggagaaagcgttgcagaagcgactatc
acaaattggttaaaacaagttggtgacaaaattgaaatggacgaagcggtgctagaaata
gctaccgataaagtagatagcgaagttcctagcgaagtttcaggaattttggtagaacaa
ttattcaacaaagatgatttagttcaagttgggcaaactattgctattatagaaactgaa
ggaggcgatgttgctgtagcaaaacaagaagcaactccagttgctgtagcagaggttgct
aaaacagtagaagctgcaaaagaagcagtttcggtaccagttaatttttcagattcagat
aaattcttttcaccattagttaagaacatcgctaaggcagaaggtgtttctgtagctgaa
ttagagagcatttctggttcaggaaaagaaggaagagttactaaagaagatcttttaaaa
tatgttgcggatagaaaaatagaaccaagaaccaagaatcaagagttggctgttgtacaa
gcaaccaagcaacaaccagtaagccaaaaagcagtgccagtttctgtaaatggaggtgac
gaaattattgaaatggatagaatgcgtaagcttatttctggttatatggtagcttcggta
caaacatcggcacacgtacaatcgtttatcgaagttgatgtaacaaatatcgtaaaatgg
agaaataaagtaaaagatgctttcgaaaaacgagaaggcgaaaaactaacttttactcca
ataatgatggaagctgtagcaaaagctttaaaggattttccaggcatgaatatttctgtt
gatggtgattatatcatcaaaaagaaaaatatcaacttaggaatggcagcggccttgcca
aacggtaatttaattgttccagttataaaaaatgcagaccaattaaatttagttggtatg
gcaaaagcggtaaatgatttaggaaatcgtgcaaaagcaggaaaattaaaaccagacgat
acacaaggcgggacttatacagtgactaatgtgggaacttttggatcggtttttggcaca
ccaattataaaccagccacaagtaggaattttagcccttggagccattaggaaagtacca
gcagttatcgaaactccagaaggagattttataggaattcgtcaaaaaatgttcctttcg
cactcatacgatcacagagttgtagatggcgcattaggaggaagtttcgtaaaacgcgtt
gcagattacttagaagcatttgatgtgaatagagatttttag

DBGET integrated database retrieval system