KEGG   Flavobacterium psychrophilum JIP02/86: FP0590Help
Entry
FP0590            CDS       T00548                                 

Gene name
bfmBB
Definition
(RefSeq) Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00020  Citrate cycle (TCA cycle)
fps00310  Lysine degradation
fps01100  Metabolic pathways
fps01110  Biosynthesis of secondary metabolites
fps01120  Microbial metabolism in diverse environments
fps01130  Biosynthesis of antibiotics
fps01200  Carbon metabolism
Module
fps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FP0590 (bfmBB)
  Amino acid metabolism
   00310 Lysine degradation
    FP0590 (bfmBB)
Enzymes [BR:fps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FP0590 (bfmBB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 5300645
NCBI-ProteinID: YP_001295511
UniProt: A6GX72
Position
780221..781522
Genome map
AA seq 433 aa AA seqDB search
MARFELKLPKMGESVAEATITNWLKQVGDKIEMDEAVLEIATDKVDSEVPSEVSGILVEQ
LFNKDDLVQVGQTIAIIETEGGDVAVAKQEATPVAVAEVAKTVEAAKEAVSVPVNFSDSD
KFFSPLVKNIAKAEGVSVAELESISGSGKEGRVTKEDLLKYVADRKIEPRTKNQELAVVQ
ATKQQPVSQKAVPVSVNGGDEIIEMDRMRKLISGYMVASVQTSAHVQSFIEVDVTNIVKW
RNKVKDAFEKREGEKLTFTPIMMEAVAKALKDFPGMNISVDGDYIIKKKNINLGMAAALP
NGNLIVPVIKNADQLNLVGMAKAVNDLGNRAKAGKLKPDDTQGGTYTVTNVGTFGSVFGT
PIINQPQVGILALGAIRKVPAVIETPEGDFIGIRQKMFLSHSYDHRVVDGALGGSFVKRV
ADYLEAFDVNRDF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatttgaattaaaacttccaaaaatgggagaaagcgttgcagaagcgactatc
acaaattggttaaaacaagttggtgacaaaattgaaatggacgaagcggtgctagaaata
gctaccgataaagtagatagcgaagttcctagcgaagtttcaggaattttggtagaacaa
ttattcaacaaagatgatttagttcaagttgggcaaactattgctattatagaaactgaa
ggaggcgatgttgctgtagcaaaacaagaagcaactccagttgctgtagcagaggttgct
aaaacagtagaagctgcaaaagaagcagtttcggtaccagttaatttttcagattcagat
aaattcttttcaccattagttaagaacatcgctaaggcagaaggtgtttctgtagctgaa
ttagagagcatttctggttcaggaaaagaaggaagagttactaaagaagatcttttaaaa
tatgttgcggatagaaaaatagaaccaagaaccaagaatcaagagttggctgttgtacaa
gcaaccaagcaacaaccagtaagccaaaaagcagtgccagtttctgtaaatggaggtgac
gaaattattgaaatggatagaatgcgtaagcttatttctggttatatggtagcttcggta
caaacatcggcacacgtacaatcgtttatcgaagttgatgtaacaaatatcgtaaaatgg
agaaataaagtaaaagatgctttcgaaaaacgagaaggcgaaaaactaacttttactcca
ataatgatggaagctgtagcaaaagctttaaaggattttccaggcatgaatatttctgtt
gatggtgattatatcatcaaaaagaaaaatatcaacttaggaatggcagcggccttgcca
aacggtaatttaattgttccagttataaaaaatgcagaccaattaaatttagttggtatg
gcaaaagcggtaaatgatttaggaaatcgtgcaaaagcaggaaaattaaaaccagacgat
acacaaggcgggacttatacagtgactaatgtgggaacttttggatcggtttttggcaca
ccaattataaaccagccacaagtaggaattttagcccttggagccattaggaaagtacca
gcagttatcgaaactccagaaggagattttataggaattcgtcaaaaaatgttcctttcg
cactcatacgatcacagagttgtagatggcgcattaggaggaagtttcgtaaaacgcgtt
gcagattacttagaagcatttgatgtgaatagagatttttag

DBGET integrated database retrieval system