KEGG   Flavobacterium psychrophilum JIP02/86: FP0590Help
Entry
FP0590            CDS       T00548                                 

Gene name
bfmBB
Definition
Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FP0590 (bfmBB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FP0590 (bfmBB)
  Amino acid metabolism
   00310 Lysine degradation
    FP0590 (bfmBB)
Enzymes [BR:fps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FP0590 (bfmBB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
780221..781522
Genome map
AA seq 433 aa AA seqDB search
MARFELKLPKMGESVAEATITNWLKQVGDKIEMDEAVLEIATDKVDSEVPSEVSGILVEQ
LFNKDDLVQVGQTIAIIETEGGDVAVAKQEATPVAVAEVAKTVEAAKEAVSVPVNFSDSD
KFFSPLVKNIAKAEGVSVAELESISGSGKEGRVTKEDLLKYVADRKIEPRTKNQELAVVQ
ATKQQPVSQKAVPVSVNGGDEIIEMDRMRKLISGYMVASVQTSAHVQSFIEVDVTNIVKW
RNKVKDAFEKREGEKLTFTPIMMEAVAKALKDFPGMNISVDGDYIIKKKNINLGMAAALP
NGNLIVPVIKNADQLNLVGMAKAVNDLGNRAKAGKLKPDDTQGGTYTVTNVGTFGSVFGT
PIINQPQVGILALGAIRKVPAVIETPEGDFIGIRQKMFLSHSYDHRVVDGALGGSFVKRV
ADYLEAFDVNRDF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatttgaattaaaacttccaaaaatgggagaaagcgttgcagaagcgactatc
acaaattggttaaaacaagttggtgacaaaattgaaatggacgaagcggtgctagaaata
gctaccgataaagtagatagcgaagttcctagcgaagtttcaggaattttggtagaacaa
ttattcaacaaagatgatttagttcaagttgggcaaactattgctattatagaaactgaa
ggaggcgatgttgctgtagcaaaacaagaagcaactccagttgctgtagcagaggttgct
aaaacagtagaagctgcaaaagaagcagtttcggtaccagttaatttttcagattcagat
aaattcttttcaccattagttaagaacatcgctaaggcagaaggtgtttctgtagctgaa
ttagagagcatttctggttcaggaaaagaaggaagagttactaaagaagatcttttaaaa
tatgttgcggatagaaaaatagaaccaagaaccaagaatcaagagttggctgttgtacaa
gcaaccaagcaacaaccagtaagccaaaaagcagtgccagtttctgtaaatggaggtgac
gaaattattgaaatggatagaatgcgtaagcttatttctggttatatggtagcttcggta
caaacatcggcacacgtacaatcgtttatcgaagttgatgtaacaaatatcgtaaaatgg
agaaataaagtaaaagatgctttcgaaaaacgagaaggcgaaaaactaacttttactcca
ataatgatggaagctgtagcaaaagctttaaaggattttccaggcatgaatatttctgtt
gatggtgattatatcatcaaaaagaaaaatatcaacttaggaatggcagcggccttgcca
aacggtaatttaattgttccagttataaaaaatgcagaccaattaaatttagttggtatg
gcaaaagcggtaaatgatttaggaaatcgtgcaaaagcaggaaaattaaaaccagacgat
acacaaggcgggacttatacagtgactaatgtgggaacttttggatcggtttttggcaca
ccaattataaaccagccacaagtaggaattttagcccttggagccattaggaaagtacca
gcagttatcgaaactccagaaggagattttataggaattcgtcaaaaaatgttcctttcg
cactcatacgatcacagagttgtagatggcgcattaggaggaagtttcgtaaaacgcgtt
gcagattacttagaagcatttgatgtgaatagagatttttag

DBGET integrated database retrieval system