KEGG   Flavobacterium psychrophilum: FP0634Help
Entry
FP0634            CDS       T00548                                 

Gene name
folE1
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fps  Flavobacterium psychrophilum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FP0634 (folE1)
Enzymes [BR:fps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     FP0634 (folE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
830501..831172
Genome map
AA seq 223 aa AA seqDB search
MSILTDKEITEILGDNHQMTSANSPIRSDAFVKTDDQKMQNIEKHFYDIMQELGLDMTDD
SLQGTPHRVAKMFIQEIFSGLDPKNKPTISTFDNEYHYDKMLVEANISFNSTCEHHFLPI
FGKAHIGYISSGKVIGLSKLNRIVDYFSRRPQVQERLIMQIFNDLKIALNTENVIVVMEA
KHLCVSSRGIKHESSFTSTIQYGGIFNEKENRNDFFNMINSEK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagtatattgactgataaagaaataactgagattttaggcgataaccaccagatgact
tctgccaactctccaatacgttcagatgcttttgtaaaaacagatgatcagaaaatgcaa
aatatcgaaaagcatttttatgatattatgcaagaattaggactcgatatgactgatgat
agcttgcaaggaacaccacatcgtgttgcaaaaatgtttatacaagaaatttttagtggc
ttagatccaaaaaataagcctaccatttctactttcgataatgaatatcattatgataaa
atgttagttgaagccaatattagcttcaattctacttgcgaacatcattttttgcccata
tttggtaaagctcatataggttatatttctagcggaaaagttatcggattatcaaaatta
aataggattgtagattatttttctcgtcgtccgcaagttcaggaacgattaattatgcaa
atttttaatgatttaaaaatagctttaaataccgaaaacgtaattgtagttatggaagcc
aaacatttatgtgtttccagtcgtggaattaagcatgaatctagttttacatcgaccata
cagtatggcgggatttttaatgaaaaagaaaatagaaatgatttttttaatatgataaat
tctgaaaaataa

DBGET integrated database retrieval system