KEGG   Flavobacterium psychrophilum: FP0634Help
Entry
FP0634            CDS       T00548                                 

Gene name
folE1
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fps  Flavobacterium psychrophilum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fps00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
830501..831172
Genome map
AA seq 223 aa AA seqDB search
MSILTDKEITEILGDNHQMTSANSPIRSDAFVKTDDQKMQNIEKHFYDIMQELGLDMTDD
SLQGTPHRVAKMFIQEIFSGLDPKNKPTISTFDNEYHYDKMLVEANISFNSTCEHHFLPI
FGKAHIGYISSGKVIGLSKLNRIVDYFSRRPQVQERLIMQIFNDLKIALNTENVIVVMEA
KHLCVSSRGIKHESSFTSTIQYGGIFNEKENRNDFFNMINSEK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagtatattgactgataaagaaataactgagattttaggcgataaccaccagatgact
tctgccaactctccaatacgttcagatgcttttgtaaaaacagatgatcagaaaatgcaa
aatatcgaaaagcatttttatgatattatgcaagaattaggactcgatatgactgatgat
agcttgcaaggaacaccacatcgtgttgcaaaaatgtttatacaagaaatttttagtggc
ttagatccaaaaaataagcctaccatttctactttcgataatgaatatcattatgataaa
atgttagttgaagccaatattagcttcaattctacttgcgaacatcattttttgcccata
tttggtaaagctcatataggttatatttctagcggaaaagttatcggattatcaaaatta
aataggattgtagattatttttctcgtcgtccgcaagttcaggaacgattaattatgcaa
atttttaatgatttaaaaatagctttaaataccgaaaacgtaattgtagttatggaagcc
aaacatttatgtgtttccagtcgtggaattaagcatgaatctagttttacatcgaccata
cagtatggcgggatttttaatgaaaaagaaaatagaaatgatttttttaatatgataaat
tctgaaaaataa

DBGET integrated database retrieval system