KEGG   Flavobacterium psychrophilum JIP02/86: FP0708Help
Entry
FP0708            CDS       T00548                                 

Definition
Probable cysteine desulfurase (EC:2.8.1.7)
Orthology
K04487  
cysteine desulfurase [EC:2.8.1.7]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Thiamine metabolism
Metabolic pathways
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    FP0708
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    FP0708
Enzymes [BR:fps01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     FP0708
Transfer RNA biogenesis [BR:fps03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    FP0708
 Prokaryotic Type
    FP0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(914145..915272)
Genome map
AA seq 375 aa AA seqDB search
MKKVYLDNAATTQLRPEVIAEMTQVLMNDYGNPSSTHALGRHSKNLVELSRKIIAKNINC
TAQEIIFTSCGTEANNFIIQSCFRDLKIERIITSKIEHHAVLHTVQILQKSYNIRIDYVN
ILPSGEIDLVHLSDLLSIEGKTLVSLMHVNNEIGTILNLNRVAKICKQYQAYFHTDTVQS
IGKTAFNLQETPIDFLVASAHKFHGPKGVGFAFIRKGILLNPILLGGEQEKGMRAGTECV
HNIVGMAKALELSYLHLDEEEKYILKLKEYTISQLKSHFPEIKFNGNPEETFYNILNIIL
PFSEEKTSMILFNLDMKGIAVSRGSACQSGSVKPSHVLAEILSKEDLKKPSLRISFSHYN
TLEDIDYLIENLKTV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtatatttagacaacgccgccactacacaactgcgaccagaagtaattgca
gaaatgacacaagtattaatgaatgattacggtaatccttcatcgactcatgccttgggt
cgtcattctaaaaatttagttgagctttcaagaaaaatcattgcaaaaaatattaattgt
actgcacaagaaataatttttacttcgtgtggtaccgaagctaataattttattattcag
tcttgctttagagatttaaaaattgaaagaataattacaagtaaaatagaacaccatgct
gttttgcacacggtacaaattcttcaaaaatcatataacattagaatagattatgtaaat
attttgccctctggcgagatagatttagtgcatctttcggatttactttctatagaagga
aaaacattagtcagtttaatgcacgtaaacaatgagattggtacgattcttaatttgaat
agagttgccaaaatatgcaaacaataccaagcttattttcatactgatacagtacaatct
attggaaaaacagccttcaatttacaagaaacccctatagattttcttgtggcgagtgcc
cataaatttcatggtccgaaaggagttggttttgcttttatacgaaaaggaatcctctta
aacccaatattattgggcggggaacaagaaaaaggaatgcgagcaggaactgaatgcgtg
cataatattgtgggaatggcaaaagcattagaattatcctatttacatttagatgaggaa
gaaaaatatattcttaagctcaaggaatataccatctcgcaattaaaatctcattttcct
gaaataaaatttaatggaaatccagaagaaacattttataatatattgaatattattttg
ccgttttctgaagaaaaaacgtcgatgattttatttaatttagatatgaaaggtattgcg
gtttcccgtggaagcgcttgtcagtcaggaagtgtaaaaccatctcatgttttagccgaa
attctttcgaaggaagatttaaaaaaaccaagtttacgaatttctttcagtcattataat
actttagaagatattgattacttaatagaaaatttaaaaacagtttaa

DBGET integrated database retrieval system