KEGG   Flavobacterium psychrophilum JIP02/86: FP0894Help
Entry
FP0894            CDS       T00548                                 

Gene name
infC
Definition
(RefSeq) Translation initiation factor IF-3
  KO
K02520  
translation initiation factor IF-3
Organism
fps  Flavobacterium psychrophilum JIP02/86
Brite
Translation factors [BR:fps03012]
 Eukaryotic Type
  Initiation factors
   MTIFs
    FP0894 (infC)
 Prokaryotic Type
   FP0894 (infC)
Mitochondrial biogenesis [BR:fps03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    FP0894 (infC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1110088..1110501)
Genome map
AA seq 137 aa AA seqDB search
MKLADQLELDLVEISPNAEPPVCKIMDYKKFVYMQKKREKELKAKSTQIVVKEIRFGPQT
DEHDYEFKRKNAEKFLKEGSKLKAFVFFKGRSIIYKDQGQILLLRLATDLEEHGKVEAMP
VLEGKRMIMFIAPKKKK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgccgaccaattagaattggatttagttgaaatttctccaaacgcagaaccg
ccagtatgtaaaattatggactataaaaagttcgtttacatgcagaagaaacgtgaaaaa
gagctaaaagctaaatcaactcaaattgtagttaaagagattcgttttggtcctcaaact
gatgaacatgattacgaatttaaaagaaaaaatgcagaaaagttcctcaaagaaggttcg
aaactaaaagcattcgtattttttaaaggacgttctattatctataaagaccaagggcaa
atcttattattaagactagcaacagatctcgaagaacatggtaaagtagaagctatgcca
gttcttgaaggaaaaagaatgattatgtttattgctccgaagaagaaaaaatag

DBGET integrated database retrieval system