KEGG   Flavobacterium psychrophilum JIP02/86: FP0942Help
Entry
FP0942            CDS       T00548                                 

Gene name
acsA
Definition
(RefSeq) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00010  Glycolysis / Gluconeogenesis
fps00620  Pyruvate metabolism
fps00640  Propanoate metabolism
fps00680  Methane metabolism
fps01100  Metabolic pathways
fps01110  Biosynthesis of secondary metabolites
fps01120  Microbial metabolism in diverse environments
fps01130  Biosynthesis of antibiotics
fps01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FP0942 (acsA)
   00620 Pyruvate metabolism
    FP0942 (acsA)
   00640 Propanoate metabolism
    FP0942 (acsA)
  Energy metabolism
   00680 Methane metabolism
    FP0942 (acsA)
Enzymes [BR:fps01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     FP0942 (acsA)
Lipid biosynthesis proteins [BR:fps01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   FP0942 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 5300882
NCBI-ProteinID: YP_001295850
UniProt: A6GY63
Position
complement(1263593..1265500)
Genome map
AA seq 635 aa AA seqDB search
MSYYKIDNLEQYFKHYNKSIREPRKFWGKIASENFTWYQECEKVVEFDMVEAKIEWFKGA
KVNIVKNCIDRHLARRGEKTAIIFEPNNPNEEALHISYNELYVRVSKMANVLREQGIEKG
DRVCIYLPMIPELAIATLACARIGAIHSVVFAGFSESAVASRINDSECKMVITSDGGFRG
EKTIDLKAIIDEALEKCPCVTKVLVVKRTNTSVKMKEGRDIWLQPLLDEALDNNMPEIMD
AEDPLFILYTSGSTGKPKGMVHTTAGYMVYSAYTFKNVFNYEDDDIFWCTADIGWITGHS
YILYGPLLNGATTVIFEGVPSYPDFSRFWEVIEKHKVTQFYTAPTAIRALAKENLSYVQK
YPLKSLKVIGSVGEPINEEAWHWYNDHVGGKRCPMVDTWWQTETGGIMISPIAFVTPTKP
TYASLPLPGIQPILMNEKRNEIEENQVSGSLCIKFPWPGIARTIWGNHQRYKETYFSAFP
GKYFTGDGALRDEVGYYRITGRVDDVVIVSGHNLGTAPIEDAINEHPAVAESAIVGFPHD
LKGNALYGFVMLKESGETRDKTNLAKEINQNVSDHIGPIAKLDKIQFVSGLPKTRSGKIM
RRILRKIAEGDFANFGDITTLLNPEIVEEIKEGKL
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagttattacaaaattgacaatctagaacaatactttaagcattacaacaaatcgatt
cgagaaccaaggaaattttgggggaaaattgcttcagaaaattttacttggtaccaagaa
tgcgaaaaagtagtagaatttgacatggttgaagccaaaatagaatggtttaaaggcgca
aaagtaaacattgtaaaaaactgtatcgataggcatttggctcgtcggggcgaaaaaaca
gcaattattttcgaaccaaacaatccaaatgaagaagccttgcatatttcgtataacgaa
ttgtatgtacgagtttctaaaatggcaaatgtattgagagaacaaggtatagaaaaagga
gacagagtttgtatttatttacctatgattccagaattagccattgcaactttggcttgc
gccagaattggagctatacactcggttgtatttgcgggattttcggaatcggcagtagcc
tcaagaataaatgattctgaatgcaaaatggttattacttccgatggtggttttcgtgga
gaaaaaaccatcgatttaaaagcaattatcgatgaagctttagaaaaatgtccatgcgta
acaaaagtcttagtcgtaaaaagaaccaacacttctgtaaaaatgaaagaaggtcgtgat
atttggttgcaaccacttttagatgaagcactagacaataatatgcctgaaattatggat
gccgaagatccgttatttattctttatacctcaggatctacaggtaaacctaaaggaatg
gtgcatacaacggctggttatatggtttactctgcctataccttcaaaaatgtttttaat
tatgaagacgatgatattttttggtgtaccgccgatattggttggataacaggacattca
tacatactttatggccctcttctaaacggagctacaacagtaatttttgaaggtgttccg
tcatatccagatttttctcgtttttgggaagtaatagaaaaacataaagttacccaattt
tatacagccccaacagctattcgtgctttggcaaaagaaaatttatcttatgtacaaaaa
tacccattaaaatcgctaaaagtcattggttctgttggagagcctattaatgaagaagct
tggcattggtacaacgaccacgtgggagggaagcgttgtcctatggtagatacttggtgg
caaaccgaaactggtggaattatgatttcgccaattgcctttgtaaccccaacaaaacca
acctacgcatcgttacctttaccaggaattcagccaattcttatgaacgaaaaacgcaac
gaaatagaagaaaatcaagtctcaggtagcttgtgcattaaatttccttggccaggaata
gcaagaaccatttggggcaaccatcagcgatataaggaaacttatttttctgcatttcct
ggaaaatattttactggagatggtgctttgcgtgacgaagtaggttattatcgaattaca
ggtcgggtagatgatgtagtcattgtttctggacataatttaggaacagcaccaatagaa
gacgcaataaatgaacatccagcagttgccgaaagtgctattgttggctttcctcatgat
ctaaaaggaaatgcattgtacggatttgtaatgctaaaagaaagcggagaaacgagagac
aaaacaaaccttgccaaagaaataaaccaaaatgtttctgaccatattggaccaatcgct
aaattagacaaaattcagtttgtatctggtttgccaaaaactcgttcaggaaaaattatg
agacgtattttacgcaaaattgcagaaggagattttgctaattttggtgatatcactact
ttattaaaccccgaaattgtagaggaaattaaagaagggaaattgtaa

DBGET integrated database retrieval system