KEGG   Flavobacterium psychrophilum JIP02/86: FP0945Help
Entry
FP0945            CDS       T00548                                 

Definition
(RefSeq) Probable ATP-dependent RNA helicase, DEAD/DEAH box family
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII CMS1 Helicase_RecD
Motif
Other DBs
NCBI-GeneID: 5300884
NCBI-ProteinID: YP_001295853
UniProt: A6GY66
Position
1259506..1260840
Genome map
AA seq 444 aa AA seqDB search
MSKQFANLGIAEPILKALLDLKITVPTEIQQKSVPVLLSSQDDFIGLAKTGTGKTAAFGL
PLLQLINVNNAKIQAVILVPTRELGNQIFTNLESFAKYLPEVSIASVCGGIPIKPQIERL
QQTTHIVVATPGRLIDLIKRGAINIKEINYLILDEADEMATALKEGLDEIAIDLPKNRKT
WLFSATMPGTVKQLVQNYMSKKVTQVSASMEIVGNSSINHEYIVVDPIEKLEVLMHFLTS
KEGQRGIIFCKTKAAVNKLAKNLAINRFSSGAIHGSLTQPIRDRIMDQFRAGHINILVAT
DLAARGIDVKEISYVVNYHLPDVHETYVHRSGRTARAGANGFSLTILQQEEIAEIADFEK
ALGIKFEKFEKPNPESIEENNAYLWAKQIFKTKPNHELSIDIKEKIKTVFHHLTKDELIE
KLMANYFLQNKPDTTPVVKRQKIK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaattcgcaaatttaggaatagcagaacccattttaaaagcattactagat
cttaaaattactgttcccacagaaattcaacaaaaatcagtgccagtattgctttccagc
caagacgattttattggattagcaaaaacaggaacaggaaaaacagcagctttcggattg
cctttattgcaattaattaacgtaaataatgctaaaatacaagccgtaatattagtgcca
accagagaattaggcaaccaaatatttacaaatttagaaagctttgctaaatatttacca
gaagtttctatagcttctgtttgtggcggaatacctataaaacctcaaatagaacgtttg
caacaaaccactcatatagtcgttgcaacaccaggaaggttgatcgatttgataaaaaga
ggcgcaataaacattaaagaaattaactatttaattcttgatgaagcagatgaaatggca
acagccctaaaagaaggattagacgaaattgctatcgatttacctaaaaacagaaaaact
tggttattttctgcaacaatgccaggaacagtaaaacaattggtacaaaactatatgtca
aaaaaagtgacacaagtaagtgctagtatggaaattgtgggtaattcgagcattaatcac
gaatatattgttgtagatccaatagaaaaattagaagttctcatgcattttttaacttca
aaagaaggacaaagaggtattattttttgcaaaaccaaagccgcagttaataaattagct
aaaaatttagccattaatcgcttttcatctggagcaatacacggaagcttaacgcaacca
atccgtgatagaatcatggatcagtttcgtgcaggacacattaatatattagtagccaca
gatttagccgctcgtggaatcgatgtaaaagaaatttcctatgtagtaaattatcattta
ccagatgtacatgaaacttatgtacaccgtagcggacgtacagcaagagctggtgctaat
ggcttttcgctaacgattttgcaacaagaagaaattgctgaaattgccgattttgaaaaa
gctttaggaattaaatttgaaaaatttgaaaaacccaatccagaaagcatcgaagaaaat
aatgcttatttgtgggcaaaacaaatcttcaaaaccaagccaaatcatgaattatcaatt
gatattaaagaaaaaataaaaacagtttttcatcatcttaccaaagatgaactgattgaa
aaattaatggctaattattttttgcaaaacaaacctgataccacaccagttgtaaaaaga
caaaaaattaaataa

DBGET integrated database retrieval system