KEGG   Flavobacterium psychrophilum JIP02/86: FP0948Help
Entry
FP0948            CDS       T00548                                 

Gene name
ydzA
Definition
(RefSeq) Protein YdzA of unknown function
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1256900..1257178)
Genome map
AA seq 92 aa AA seqDB search
MLKFFKYLAITEGISALLLFFFAMPMKYVFHNPIYVKHLGMAHGILFTTYIILATILKFK
ENWTVKKYAEICLASIPPFGTFYIEKKYLKDA
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaatttttcaaatatcttgcaattacagaaggaatttctgccctattattattc
ttctttgcgatgcctatgaaatatgtttttcataatcctatatatgtaaaacatttagga
atggcacacggaatactatttactacttacatcattctcgccacgatattaaaatttaaa
gaaaattggactgtaaaaaaatatgccgaaatttgcctagcttctatccctccttttggt
acattttacatcgaaaaaaaatacttaaaagatgcttaa

DBGET integrated database retrieval system