KEGG   Flavobacterium psychrophilum JIP02/86: FP0950Help
Entry
FP0950            CDS       T00548                                 

Definition
(RefSeq) acyl-CoA thioesterase
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1255115..1255501
Genome map
AA seq 128 aa AA seqDB search
MRFHTRKWVKPEDLNPNHSLFGGKLLAWIDEEAALYSIVQLENPRVVTKHMSEINFVSSA
KQGDIIEIGLDVVKFGNSSLILKCEVRNIMTRETIITIDSITMVSLGEEGKPKAHGKTEI
EFVRNRIK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagatttcacacacgaaaatgggtaaaaccagaggatttaaaccctaatcattctctt
tttggaggaaaactattggcttggatagatgaagaagcggctttatattcgatagttcaa
ttagaaaatccgagagtagttactaaacacatgtcggaaattaactttgtaagttcggca
aaacaaggagatattatcgaaattggacttgatgtagtaaagtttggcaactcatcatta
atcctaaaatgtgaagtaagaaacatcatgacaagagaaactattattacaatagattct
attacaatggtaagtttaggtgaagaaggaaaaccaaaagcacacggaaagactgaaatt
gaatttgtgagaaataggataaagtag

DBGET integrated database retrieval system