KEGG   Flavobacterium psychrophilum JIP02/86: FP0958Help
Entry
FP0958            CDS       T00548                                 

Gene name
hisC
Definition
(RefSeq) Histidinol-phosphate transaminase
  KO
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    FP0958 (hisC)
   00350 Tyrosine metabolism
    FP0958 (hisC)
   00360 Phenylalanine metabolism
    FP0958 (hisC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FP0958 (hisC)
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    FP0958 (hisC)
Enzymes [BR:fps01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     FP0958 (hisC)
Amino acid related enzymes [BR:fps01007]
 Aminotransferase (transaminase)
  Class II
   FP0958 (hisC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1249107..1250147
Genome map
AA seq 346 aa AA seqDB search
MNNFNINNLVRENIKNMQAYASARDEFKDFTHNMVYLDANENPFSNGINRYPDPQQKKLK
GFLAQQNKINENQMLLGNGSDEVLDLVFRAFCEPNVDNVITLPPTYGMYGVLANINAIEN
KEVLLSANFQPNINEILKNINENTKIIFLCSPNNPTGNSFDDQAVLTLLKNFNGLVVIDE
AYIDFSKNGSWLHVISDYPNLLITQTLSKAYAMAGLRIGILYASAAIISILNKIKPPYNI
NNLSQESALKKLEQSTLNFHVKKIINERKKMVQSLISIPFIEKIYPSDANFILIKVEDAN
KRYNQLIEKGIVIRNRSNQPLCENCLRITIGTKEENEKLITVLKAL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttcaatatcaataatctcgttagagaaaatataaaaaatatgcaagcgtat
gcttctgcacgagatgaatttaaagattttacgcacaatatggtttatcttgatgccaat
gaaaatccgttttctaatggaattaatcgatatccagatccgcaacaaaaaaaattgaaa
ggttttttagcacagcaaaacaagatcaatgaaaatcaaatgctattaggaaatggaagc
gacgaagtactagatttagtattcagagccttttgtgaacccaatgtagacaatgtaatt
acgcttccgccaacgtacggaatgtatggcgttttggctaatattaatgctatcgaaaac
aaagaagttttattatctgctaattttcaacctaatattaatgaaatactaaagaatata
aatgagaatactaaaattattttcctttgttcgcccaataatccaacaggaaattctttt
gatgaccaagctgttttaaccttgctaaaaaactttaacggattagtagttattgatgaa
gcctatatcgatttttctaaaaatggcagttggttgcacgtaataagcgattatccaaat
cttcttattacacaaacactttctaaagcgtatgccatggcaggtttaagaataggaatt
ttatatgcttctgcagctataatttcgatattaaataagataaaaccaccgtataacatc
aataatttatcacaagaatcggctttaaaaaaactagaacaaagtaccttaaatttccat
gtcaaaaaaattataaatgagcgaaaaaaaatggttcaatctttaatttctataccattt
atagaaaaaatatacccttcggatgctaattttattctgataaaagtagaggatgccaac
aaaagatacaaccagctaatcgaaaaaggaatcgtcattagaaacagaagcaatcagcct
ttgtgcgaaaattgtttgagaattacgattggaaccaaagaagaaaacgaaaaattaata
acagttttaaaagcattataa

DBGET integrated database retrieval system