KEGG   Flavobacterium psychrophilum JIP02/86: FP0960Help
Entry
FP0960            CDS       T00548                                 

Gene name
hisG
Definition
(RefSeq) ATP phosphoribosyltransferase
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00340  Histidine metabolism
fps01100  Metabolic pathways
fps01110  Biosynthesis of secondary metabolites
fps01230  Biosynthesis of amino acids
Module
fps_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    FP0960 (hisG)
Enzymes [BR:fps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     FP0960 (hisG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisG HisG_C NMT1 KORA
Motif
Other DBs
NCBI-GeneID: 5298955
NCBI-ProteinID: YP_001295868
UniProt: A6GY81
Position
1246956..1247813
Genome map
AA seq 285 aa AA seqDB search
MSTLKIAIQKSGRLNEDSLKILKDCGILIDNGNDQLKASASNFPLEVLFLRNSDIPQYLI
DGVVDIAIVGDNILVEKGGNIKIAEKLGFSKCRVSVAVPKSFNFKSLDDLKNKRMATSYP
NTTLNYFKNNDIKVELHEISGSVEIAPNIGLADAIVDIVSSGNTLFKNNLKEVAVIMKSE
AVLAVSPLITLKKQEILDKLRFRIQSVLRARKAKYILMNVPNDKIQAITEILPVLKSPTV
VPLSEVGWCSVQSVIDEDQFWEVIDKLKAAGAEGILVCPIEKMVI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagtactctaaaaattgcaattcaaaaatcaggtcgccttaacgaggatagcttaaaa
attttaaaagattgtggcattttaatcgacaatggaaacgaccaacttaaagcatctgct
tcaaattttcctttagaagtattatttcttcgaaactcagatattcctcaatatttaata
gatggtgttgtagatattgctattgttggggataatattttagtcgaaaaaggaggaaat
attaaaattgccgaaaaattgggattttctaaatgccgagtttctgtagcagttcctaaa
tcttttaattttaagtctttagatgatttaaaaaataagagaatggcaacttcttatccc
aatacaactttaaattattttaaaaacaacgatataaaagtcgaattacacgaaatatct
gggtcggtagaaattgcgccaaatattggtctggccgatgctattgttgatattgtttct
agcggaaatactctttttaaaaacaatttgaaagaagttgctgtcatcatgaaaagtgaa
gctgttctggctgtttcacctctaattactcttaaaaaacaagaaattttagataagtta
agattcagaattcaatcggtacttagggctagaaaagcaaaatatattttgatgaatgtg
ccaaacgacaaaatacaggccataaccgaaattttacccgtattaaaaagtccaacagtg
gtgcctttaagtgaagtaggttggtgtagtgtacaatcagttatagacgaagatcaattt
tgggaagtaatcgataaattgaaagcggctggtgccgaaggtattctcgtttgtccaatt
gaaaaaatggttatttaa

DBGET integrated database retrieval system