KEGG   Flavobacterium psychrophilum JIP02/86: FP0963Help
Entry
FP0963            CDS       T00548                                 

Definition
(RefSeq) Probable transmembrane protein of unknown function
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1241924..1243951
Genome map
AA seq 675 aa AA seqDB search
MNTNTILLIILSLVTAGGLSFYQYFYKNKNYNKVNFLLALLRFISIFSIILLLINPVISR
KTYETSKTPLPIIVDNSQSISELKQEKISKELSQKLLENTQLNDKYDVQLFSFDNDFYTN
KPIDYKGKQTNIHKVAQNMKQLYRNQNFPIVLLSDGNQTIGNDYVYSFPQNNQLYPLVLG
DTTSFLDIKINQLNVNKYAFLKNKFPVEVFLQYNGDKSINTTFSIQEGNHTIHKQIISFS
ANKKSQEISVLLNANKVGVHSYKASITTSEIEKNKYNNTKNFAVEIIDQRSEIALISAIN
HPDLGAIKRAIETNVQHKVTLVKPQQIKSLNSYNVLILYQPNIQFKPILEQNKNLQLNTF
VITGLSTDYNILNEYQDQLKFRMSNQNENFTAQFNPEFNLFALDNIGFEQFPPLENSFGN
INITGNVNTLLQSQIRNINTKNPLLAFAESGIKRNAYLFGENIWKWRLESHVKTKSFEQF
DIFIDKIIQFLASNVSKKSLIVTHESFYNSGENIEVSAQFFNKNYEFEENAKLTIQLKNN
KTKTTKVYDFLKGNGEYKVNLDGLEAGNYSFTVKENNSKASYSNKFEVLYFEIEKQFVNP
DISRLTQLARNTNSKIFYPNQVDKLITELLKKESFPAIQKEIVKKSALIESIWLLILLAI
TLATEWFIRKYNGML
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaataccaacacgattctactcataatactttctttagtaactgctggaggattgtcg
ttttaccaatatttttataaaaataaaaactacaacaaggtcaattttttattggctttg
ttgcgttttatttctattttttctatcattttattgctaattaatccagttatatcaaga
aaaacctacgaaacaagtaaaacaccattaccaataattgtagataattctcaatctata
tcagaattaaaacaagaaaaaatatcgaaagaattatctcaaaaattattagaaaacact
cagttgaatgacaaatatgatgttcaattgtttagttttgataatgatttttacactaac
aaaccaatagattataaaggaaaacaaaccaatattcataaagttgctcaaaacatgaag
caattatatcgaaatcaaaattttccaattgtattgctgtcagacggaaaccaaaccatt
ggaaacgattatgtatattcatttcctcaaaacaatcaactctatccattagtattaggt
gatacaacgagctttttagatataaaaattaatcaattgaatgtaaataaatacgcattc
ttaaaaaataaatttccagtcgaagttttcttacaatacaacggcgacaaaagcatcaat
accacatttagtattcaagaaggaaatcatacaattcacaaacaaatcatttctttttct
gccaacaagaaatcgcaagaaatatctgttttgctaaacgctaataaagtaggagttcat
tcttataaagcaagtattacaacttcagaaatagagaaaaataaatataataacactaaa
aattttgcggtcgaaattatagaccagcgatcagaaattgcattaatatcagcaataaat
catccagatttaggggctataaaacgagctatagaaactaatgtacaacacaaagtaacg
cttgttaaaccacagcaaattaaatcattaaatagttataatgttttaatattataccag
cccaatatccaatttaaacctattttagagcaaaataaaaacctacaattaaacactttt
gtaattacaggattaagtacagattataacattctgaatgaataccaagaccaattgaaa
tttagaatgtctaatcagaatgaaaattttacagctcaatttaatcctgaatttaattta
tttgctttagataatattggtttcgaacagtttcctcctttagaaaattcgtttgggaat
ataaatattacagggaatgtaaatactttattgcaatctcaaattaggaatattaatact
aaaaacccattattggcttttgcagaaagcggaataaaacgaaatgcctatctttttgga
gagaatatctggaaatggcgtctagaaagtcatgtaaaaactaaatcattcgaacaattt
gatatttttatagataaaattattcagtttttagcctctaatgtttcaaaaaaatctcta
attgttacgcacgaaagcttttataattctggtgaaaatatcgaagtttcagctcaattt
tttaataaaaattatgaatttgaagaaaatgcaaaattaaccattcagttaaaaaacaat
aaaacaaaaaccacaaaagtatatgattttttaaaaggaaatggcgaatataaagtaaat
ctagacggtttagaagctggaaattatagcttcactgtcaaagaaaataattcgaaagct
tcctattcaaataaatttgaagttttatattttgaaattgaaaagcaatttgtaaatcct
gatatttctcgtttaactcagttagcaagaaacacgaactcgaaaatattttatccaaat
caagtagataaattaattaccgaactacttaaaaaggaaagttttccagccattcagaaa
gaaatagttaaaaaatctgctctaatagagtcaatttggttattaattcttttagcaatt
actttagccacagaatggtttattagaaaatacaacggaatgctataa

DBGET integrated database retrieval system