KEGG   Flavobacterium psychrophilum JIP02/86: FP0965Help
Entry
FP0965            CDS       T00548                                 

Definition
(RefSeq) Probable DNA polymerase III subunit
  KO
K02343  
DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FP0965
   00240 Pyrimidine metabolism
    FP0965
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    FP0965
   03430 Mismatch repair
    FP0965
   03440 Homologous recombination
    FP0965
Enzymes [BR:fps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     FP0965
DNA replication proteins [BR:fps03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     FP0965
DNA repair and recombination proteins [BR:fps03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     FP0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1239309..1240394)
Genome map
AA seq 361 aa AA seqDB search
MEQFVVSARKYRPQTFKDVVGQQAITNTLLNAIETNHLASALLFTGPRGVGKTTCARILA
RKINQPGYDDPNEDFAFNVFELDAASNNSVDDIRNLIDQVRIPPQTGQYKVYIIDEVHML
SSAAFNAFLKTLEEPPKHAIFILATTEKHKIIPTILSRCQIFDFKRITVKDAKEHLAEVA
TNQGVIFEDDALHIIAQKADGAMRDALSIFDRVVSFCGKNLTRQAVTENLNVLDYETYIN
VTNLILENKIPELLLAYNDILAKGFDGHHFVAGLASHFRDLLVSKTPATITLLEVGEQAQ
KMYYVQSQKASQDFLLQGIDLANDCDLKFKLSQNQRLLVELCLMQLASITFDGEKKKLNN
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatttgtagtatcggctcgtaaatatcgtccgcaaacgtttaaagacgtggtg
gggcaacaagccattaccaatacgttactaaatgcgatagaaacaaatcatttggcatca
gccctattatttactggtcctcgtggcgtaggaaaaacaacttgtgccagaattttagcc
agaaaaataaaccaaccaggttacgacgacccgaacgaagattttgctttcaatgttttc
gaactcgatgcggcttcaaacaattcggtcgatgatattcgtaatctaatcgatcaagtt
cgtatccccccacaaacgggacaatataaagtttatattatcgatgaggttcacatgtta
tcatctgcagcatttaatgcttttttgaaaacattagaagaaccaccaaaacatgccatt
tttattttggcaacgaccgaaaaacataaaattattccaacgatattatctcgttgtcag
atattcgatttcaaaagaattactgtaaaagatgccaaggaacatctcgccgaagtagct
accaatcaaggtgtcattttcgaagacgatgctttgcatattattgcccaaaaagcagat
ggtgccatgcgcgatgctttgtctatttttgatagagttgtgtctttttgtggaaaaaac
ctaacacgacaagcagttaccgaaaacttgaatgtgctagattatgaaacctatattaat
gtaacgaatttaattttagaaaataaaattccagaattactattggcttacaacgatatt
ttggcaaaaggtttcgatgggcatcattttgtagctggattggcttcgcattttagagat
ttgttggttagcaaaacccctgcaactatcactttactagaagttggcgagcaagctcaa
aaaatgtattatgtacaatctcaaaaagcttcacaagattttctgttacaaggaatcgat
ttggctaatgattgtgatttaaaatttaagctttctcaaaaccagcgattactagtagaa
ctttgtttgatgcaactagcctctatcacttttgatggagaaaaaaaaaagctaaacaat
atataa

DBGET integrated database retrieval system