KEGG   Flavobacterium psychrophilum JIP02/86: FP0971Help
Entry
FP0971            CDS       T00548                                 

Definition
(RefSeq) Hypothetical protein
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1234076..1234246
Genome map
AA seq 56 aa AA seqDB search
MDTTTFSQEINVFHGKIAPEKAILVGYDAVTEALQLQIPFPNKLSLISKKKTELRR
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atggatactaccactttttcacaagaaatcaatgtttttcacgggaaaatagcgcccgaa
aaagccattttagtaggatatgatgctgttacagaagcactgcaattgcagataccattc
cctaataagttgtccctaatcagtaaaaaaaagacggagttacgaagatga

DBGET integrated database retrieval system